Human GRP/BN/GRP-10 ORF/cDNA clone-Lentivirus particle (NM_002091)

Cat. No.: vGMLP002238

Pre-made Human GRP/BN/GRP-10 Lentiviral expression plasmid for GRP lentivirus packaging, GRP lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to GRP/BN products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP002238 Human GRP Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP002238
Gene Name GRP
Accession Number NM_002091
Gene ID 2922
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 447 bp
Gene Alias BN,GRP-10,preproGRP,proGRP
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGCGCGGCCGTGAGCTCCCGCTGGTCCTGCTGGCGCTGGTCCTCTGCCTGGCGCCCCGGGGGCGAGCGGTCCCGCTGCCTGCGGGCGGAGGGACCGTGCTGACCAAGATGTACCCGCGCGGCAACCACTGGGCGGTGGGGCACTTAATGGGGAAAAAGAGCACAGGGGAGTCTTCTTCTGTTTCTGAGAGAGGGAGCCTGAAGCAGCAGCTGAGAGAGTACATCAGGTGGGAAGAAGCTGCAAGGAATTTGCTGGGTCTCATAGAAGCAAAGGAGAACAGAAACCACCAGCCACCTCAACCCAAGGCCCTGGGCAATCAGCAGCCTTCGTGGGATTCAGAGGATAGCAGCAACTTCAAAGATGTAGGTTCAAAAGGCAAAGTTGGTAGACTCTCTGCTCCAGGTTCTCAACGTGAAGGAAGGAACCCCCAGCTGAACCAGCAATGA
ORF Protein Sequence MRGRELPLVLLALVLCLAPRGRAVPLPAGGGTVLTKMYPRGNHWAVGHLMGKKSTGESSSVSERGSLKQQLREYIRWEEAARNLLGLIEAKENRNHQPPQPKALGNQQPSWDSEDSSNFKDVGSKGKVGRLSAPGSQREGRNPQLNQQ

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-SE0960-Ab Anti-GRP/ BN-10/ preproGRP functional antibody
    Target Antigen GM-Tg-g-SE0960-Ag GRP protein
    ORF Viral Vector pGMLP002238 Human GRP Lentivirus plasmid
    ORF Viral Vector vGMLP002238 Human GRP Lentivirus particle


    Target information

    Target ID GM-SE0960
    Target Name GRP
    Gene Group Identifier
    (Target Gene ID in Homo species)
    2922
    Gene ID 100050124 (Equus caballus), 109493482 (Felis catus), 171101 (Rattus norvegicus), 225642 (Mus musculus)
    2922 (Homo sapiens), 610154 (Canis lupus familiaris), 615323 (Bos taurus), 696983 (Macaca mulatta)
    Gene Symbols & Synonyms GRP,Grp,BLP,BN,GRP-10,proGRP,preproGRP
    Target Alternative Names BLP,BN,GRP,GRP-10,Gastrin-releasing peptide,Grp,preproGRP,proGRP
    Uniprot Accession P07492,P08989,P24393,Q863C3,Q8R1I2
    Additional SwissProt Accessions: P24393,Q8R1I2,P07492,P08989,Q863C3
    Uniprot Entry Name
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Diagnostics Biomarker
    Disease
    Disease from KEGG Neuroactive ligand-receptor interaction
    Gene Ensembl ENSECAG00000019600, ENSMUSG00000024517, ENSG00000134443, ENSCAFG00845000570, ENSBTAG00000004796, ENSMMUG00000007584
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.