Human EPO/EP/MVCD2 ORF/cDNA clone-Lentivirus particle (NM_000799.3)

Cat. No.: vGMLP002230

Pre-made Human EPO/EP/MVCD2 Lentiviral expression plasmid for EPO lentivirus packaging, EPO lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to EPO/Erythropoietin/EPO/EP products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP002230 Human EPO Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP002230
Gene Name EPO
Accession Number NM_000799.3
Gene ID 2056
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 582 bp
Gene Alias EP,MVCD2
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGGGGTGCACGAATGTCCTGCCTGGCTGTGGCTTCTCCTGTCCCTGCTGTCGCTCCCTCTGGGCCTCCCAGTCCTGGGCGCCCCACCACGCCTCATCTGTGACAGCCGAGTCCTGGAGAGGTACCTCTTGGAGGCCAAGGAGGCCGAGAATATCACGACGGGCTGTGCTGAACACTGCAGCTTGAATGAGAATATCACTGTCCCAGACACCAAAGTTAATTTCTATGCCTGGAAGAGGATGGAGGTCGGGCAGCAGGCCGTAGAAGTCTGGCAGGGCCTGGCCCTGCTGTCGGAAGCTGTCCTGCGGGGCCAGGCCCTGTTGGTCAACTCTTCCCAGCCGTGGGAGCCCCTGCAGCTGCATGTGGATAAAGCCGTCAGTGGCCTTCGCAGCCTCACCACTCTGCTTCGGGCTCTGGGAGCCCAGAAGGAAGCCATCTCCCCTCCAGATGCGGCCTCAGCTGCTCCACTCCGAACAATCACTGCTGACACTTTCCGCAAACTCTTCCGAGTCTACTCCAATTTCCTCCGGGGAAAGCTGAAGCTGTACACAGGGGAGGCCTGCAGGACAGGGGACAGATGA
ORF Protein Sequence MGVHECPAWLWLLLSLLSLPLGLPVLGAPPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYAWKRMEVGQQAVEVWQGLALLSEAVLRGQALLVNSSQPWEPLQLHVDKAVSGLRSLTTLLRALGAQKEAISPPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGDR

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T07958-Ab Anti-EPO/ DBAL/ ECYT5 functional antibody
    Target Antigen GM-Tg-g-T07958-Ag EPO protein
    ORF Viral Vector pGMLP002230 Human EPO Lentivirus plasmid
    ORF Viral Vector pGMPC004899 Human EPO Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector vGMLP002230 Human EPO Lentivirus particle


    Target information

    Target ID GM-T07958
    Target Name EPO/Erythropoietin
    Gene Group Identifier
    (Target Gene ID in Homo species)
    2056
    Gene ID 100033849 (Equus caballus), 13856 (Mus musculus), 2056 (Homo sapiens), 24335 (Rattus norvegicus)
    280784 (Bos taurus), 404002 (Canis lupus familiaris), 493801 (Felis catus), 719294 (Macaca mulatta)
    Gene Symbols & Synonyms EPO,Epo,EP,DBAL,ECYT5,MVCD2
    Target Alternative Names DBAL,ECYT5,EP,EPO,Epo,Erythropoietin,MVCD2
    Uniprot Accession P01588,P07321,P29676,P33707,P33708,P48617,Q28513,Q867B1
    Additional SwissProt Accessions: Q867B1,P07321,P01588,P29676,P48617,P33707,P33708,Q28513
    Uniprot Entry Name
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Therapeutics Target, Diagnostics Biomarker
    Disease Asthma, prolonged cough, lung function assessment, Eosinophilic airway inflammation, breast cancer, Sepsis
    Disease from KEGG Cytokine-cytokine receptor interaction, HIF-1 signaling pathway, PI3K-Akt signaling pathway, JAK-STAT signaling pathway, Hematopoietic cell lineage, Pathways in cancer
    Gene Ensembl ENSECAG00000010733, ENSMUSG00000029711, ENSG00000130427, ENSBTAG00000003430, ENSCAFG00845001075, ENSMMUG00000022863
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.