Human BAK1/BAK/BAK-LIKE ORF/cDNA clone-Lentivirus particle (NM_001188)

Cat. No.: vGMLP002040

Pre-made Human BAK1/BAK/BAK-LIKE Lentiviral expression plasmid for BAK1 lentivirus packaging, BAK1 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to BAK/BAK1/BAK1/BAK products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

pdf MSDS
pdf Datasheet

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP002040 Human BAK1 Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP002040
Gene Name BAK1
Accession Number NM_001188
Gene ID 578
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 636 bp
Gene Alias BAK,BAK-LIKE,BCL2L7,CDN1
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCTTCGGGGCAAGGCCCAGGTCCTCCCAGGCAGGAGTGCGGAGAGCCTGCCCTGCCCTCTGCTTCTGAGGAGCAGGTAGCCCAGGACACAGAGGAGGTTTTCCGCAGCTACGTTTTTTACCGCCATCAGCAGGAACAGGAGGCTGAAGGGGTGGCTGCCCCTGCCGACCCAGAGATGGTCACCTTACCTCTGCAACCTAGCAGCACCATGGGGCAGGTGGGACGGCAGCTCGCCATCATCGGGGACGACATCAACCGACGCTATGACTCAGAGTTCCAGACCATGTTGCAGCACCTGCAGCCCACGGCAGAGAATGCCTATGAGTACTTCACCAAGATTGCCACCAGCCTGTTTGAGAGTGGCATCAATTGGGGCCGTGTGGTGGCTCTTCTGGGCTTCGGCTACCGTCTGGCCCTACACGTCTACCAGCATGGCCTGACTGGCTTCCTAGGCCAGGTGACCCGCTTCGTGGTCGACTTCATGCTGCATCACTGCATTGCCCGGTGGATTGCACAGAGGGGTGGCTGGGTGGCAGCCCTGAACTTGGGCAATGGTCCCATCCTGAACGTGCTGGTGGTTCTGGGTGTGGTTCTGTTGGGCCAGTTTGTGGTACGAAGATTCTTCAAATCATGA
ORF Protein Sequence MASGQGPGPPRQECGEPALPSASEEQVAQDTEEVFRSYVFYRHQQEQEAEGVAAPADPEMVTLPLQPSSTMGQVGRQLAIIGDDINRRYDSEFQTMLQHLQPTAENAYEYFTKIATSLFESGINWGRVVALLGFGYRLALHVYQHGLTGFLGQVTRFVVDFMLHHCIARWIAQRGGWVAALNLGNGPILNVLVVLGVVLLGQFVVRRFFKS

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP0150-Ab Anti-BAK monoclonal antibody
    Target Antigen GM-Tg-g-IP0150-Ag BAK/BAK1 protein
    ORF Viral Vector pGMLP002040 Human BAK1 Lentivirus plasmid
    ORF Viral Vector vGMLP002040 Human BAK1 Lentivirus particle


    Target information

    Target ID GM-IP0150
    Target Name BAK/BAK1
    Gene Group Identifier
    （Target Gene ID in Homo species)         		578
    Gene ID 100061755 (Equus caballus), 101093435 (Felis catus), 116502 (Rattus norvegicus), 12018 (Mus musculus)
    481744 (Canis lupus familiaris), 514090 (Bos taurus), 578 (Homo sapiens), 706534 (Macaca mulatta)
    Gene Symbols & Synonyms BAK1,Bak1,Bak,N-Bak,N-BAK1,BAK,CDN1,BCL2L7,BAK-LIKE
    Target Alternative Names Apoptosis regulator BAK,BAK,BAK-LIKE,BAK1,BCL2L7,Bak,Bak1,Bcl-2 homologous antagonist/killer,Bcl-2-like protein 7 (Bcl2-L-7),CDN1,N-BAK1,N-Bak
    Uniprot Accession O08734,Q16611
    Additional SwissProt Accessions: O08734,Q16611
    Uniprot Entry Name
    Protein Sub-location Introcelluar Protein
    Category Therapeutics Target
    Disease cancer
    Disease from KEGG Protein processing in endoplasmic reticulum, Apoptosis, Apoptosis - multiple species, Pathogenic Escherichia coli infection, Hepatitis C, Measles, Human cytomegalovirus infection, Influenza A, Human papillomavirus infection, Kaposi sarcoma-associated herpesvirus infection, Epstein-Barr virus infection, Pathways in cancer, Colorectal cancer, Pancreatic cancer, Endometrial cancer, Glioma, Thyroid cancer, Basal cell carcinoma, Melanoma, Chronic myeloid leukemia, Small cell lung cancer, Non-small cell lung cancer, Breast cancer, Hepatocellular carcinoma, Gastric cancer
    Gene Ensembl ENSECAG00000023902, ENSMUSG00000057789, ENSCAFG00845023547, ENSG00000030110, ENSMMUG00000063304
    Target Classification Tumor-associated antigen (TAA)


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.