Human TNFSF12/APO3L/DR3LG ORF/cDNA clone-Lentivirus particle (NM_003809.2)

Cat. No.: vGMLP002011

Pre-made Human TNFSF12/APO3L/DR3LG Lentiviral expression plasmid for TNFSF12 lentivirus packaging, TNFSF12 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to TNFSF12/TWEAK/TNFSF12/APO3L products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

pdf MSDS
pdf Datasheet

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP002011 Human TNFSF12 Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP002011
Gene Name TNFSF12
Accession Number NM_003809.2
Gene ID 8742
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 750 bp
Gene Alias APO3L,DR3LG,TNLG4A,TWEAK
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCCGCCCGTCGGAGCCAGAGGCGGAGGGGGCGCCGGGGGGAGCCGGGCACCGCCCTGCTGGTCCCGCTCGCGCTGGGCCTGGGCCTGGCGCTGGCCTGCCTCGGCCTCCTGCTGGCCGTGGTCAGTTTGGGGAGCCGGGCATCGCTGTCCGCCCAGGAGCCTGCCCAGGAGGAGCTGGTGGCAGAGGAGGACCAGGACCCGTCGGAACTGAATCCCCAGACAGAAGAAAGCCAGGATCCTGCGCCTTTCCTGAACCGACTAGTTCGGCCTCGCAGAAGTGCACCTAAAGGCCGGAAAACACGGGCTCGAAGAGCGATCGCAGCCCATTATGAAGTTCATCCACGACCTGGACAGGACGGAGCGCAGGCAGGTGTGGACGGGACAGTGAGTGGCTGGGAGGAAGCCAGAATCAACAGCTCCAGCCCTCTGCGCTACAACCGCCAGATCGGGGAGTTTATAGTCACCCGGGCTGGGCTCTACTACCTGTACTGTCAGGTGCACTTTGATGAGGGGAAGGCTGTCTACCTGAAGCTGGACTTGCTGGTGGATGGTGTGCTGGCCCTGCGCTGCCTGGAGGAATTCTCAGCCACTGCGGCGAGTTCCCTCGGGCCCCAGCTCCGCCTCTGCCAGGTGTCTGGGCTGTTGGCCCTGCGGCCAGGGTCCTCCCTGCGGATCCGCACCCTCCCCTGGGCCCATCTCAAGGCTGCCCCCTTCCTCACCTACTTCGGACTCTTCCAGGTTCACTGA
ORF Protein Sequence MAARRSQRRRGRRGEPGTALLVPLALGLGLALACLGLLLAVVSLGSRASLSAQEPAQEELVAEEDQDPSELNPQTEESQDPAPFLNRLVRPRRSAPKGRKTRARRAIAAHYEVHPRPGQDGAQAGVDGTVSGWEEARINSSSPLRYNRQIGEFIVTRAGLYYLYCQVHFDEGKAVYLKLDLLVDGVLALRCLEEFSATAASSLGPQLRLCQVSGLLALRPGSSLRIRTLPWAHLKAAPFLTYFGLFQVH

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T46524-Ab Anti-TNF12/ TWEAK/ TNFSF12 monoclonal antibody
    Target Antigen GM-Tg-g-T46524-Ag TWEAK/TNFSF12 VLP (virus-like particle)
    Cytokine cks-Tg-g-GM-T46524 Tumor necrosis factor superfamily member 12 (TNFSF12) protein & antibody
    ORF Viral Vector pGMLP002011 Human TNFSF12 Lentivirus plasmid
    ORF Viral Vector vGMLP002011 Human TNFSF12 Lentivirus particle


    Target information

    Target ID GM-T46524
    Target Name TNFSF12/TWEAK
    Gene Group Identifier
    （Target Gene ID in Homo species)         		8742
    Gene ID 100061872 (Equus caballus), 100551513 (Bos taurus), 100568280 (Canis lupus familiaris), 101098755 (Felis catus)
    21944 (Mus musculus), 360548 (Rattus norvegicus), 8742 (Homo sapiens)
    Gene Symbols & Synonyms TNFSF12,LOC101098755,Tnfsf12,TNLG4A,TWEAK,Dr3l,Apo3l,Dr3lg,Tweak,Tnlg4a,APO3L,DR3LG
    Target Alternative Names TNFSF12, TWEAK,Tumor necrosis factor ligand superfamily member 12,APO3 ligand, TNF-related weak inducer of apoptosis (TWEAK),APO3L,DR3LG,TWEAK,TNLG4A
    Uniprot Accession O43508,O54907
    Additional SwissProt Accessions: O54907,O43508
    Uniprot Entry Name
    Protein Sub-location Transmembrane Protein
    Category Therapeutics Target, Cytokine Target
    Disease Prostate Cancer
    Disease from KEGG Cytokine-cytokine receptor interaction
    Gene Ensembl ENSECAG00000059252, ENSBTAG00000031725, ENSMUSG00000097328, ENSG00000239697
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.