Human TNFSF12/APO3L/DR3LG ORF/cDNA clone-Lentivirus particle (NM_003809.2)
Cat. No.: vGMLP002011
Pre-made Human TNFSF12/APO3L/DR3LG Lentiviral expression plasmid for TNFSF12 lentivirus packaging, TNFSF12 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.
Go to
TNFSF12/TWEAK/TNFSF12/APO3L products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Catalog No. | Product Name | lentivirus Grade | lentivirus quantity |
---|---|---|---|
vGMLP002011 | Human TNFSF12 Lentivirus particle | Pilot Grade | 1.0E+8TU |
5.0E+8TU | |||
1.0E+9TU | |||
Research Grade | 1.0E+8TU | ||
5.0E+8TU | |||
1.0E+9TU | |||
GMP-like Grade | inquiry | ||
GMP Grade | inquiry |
Product Description
Catalog ID | vGMLP002011 |
Gene Name | TNFSF12 |
Accession Number | NM_003809.2 |
Gene ID | 8742 |
Species | Human |
Product Type | Lentivirus particle (overexpression) |
Insert Length | 750 bp |
Gene Alias | APO3L,DR3LG,TNLG4A,TWEAK |
Fluorescent Reporter | ZsGreen |
Mammalian Cell Selection | Puromyocin |
Fusion Tag | 3xflag (C-Terminal) |
Promoter | CMV |
Resistance | Amplicin |
ORF Nucleotide Sequence | ATGGCCGCCCGTCGGAGCCAGAGGCGGAGGGGGCGCCGGGGGGAGCCGGGCACCGCCCTGCTGGTCCCGCTCGCGCTGGGCCTGGGCCTGGCGCTGGCCTGCCTCGGCCTCCTGCTGGCCGTGGTCAGTTTGGGGAGCCGGGCATCGCTGTCCGCCCAGGAGCCTGCCCAGGAGGAGCTGGTGGCAGAGGAGGACCAGGACCCGTCGGAACTGAATCCCCAGACAGAAGAAAGCCAGGATCCTGCGCCTTTCCTGAACCGACTAGTTCGGCCTCGCAGAAGTGCACCTAAAGGCCGGAAAACACGGGCTCGAAGAGCGATCGCAGCCCATTATGAAGTTCATCCACGACCTGGACAGGACGGAGCGCAGGCAGGTGTGGACGGGACAGTGAGTGGCTGGGAGGAAGCCAGAATCAACAGCTCCAGCCCTCTGCGCTACAACCGCCAGATCGGGGAGTTTATAGTCACCCGGGCTGGGCTCTACTACCTGTACTGTCAGGTGCACTTTGATGAGGGGAAGGCTGTCTACCTGAAGCTGGACTTGCTGGTGGATGGTGTGCTGGCCCTGCGCTGCCTGGAGGAATTCTCAGCCACTGCGGCGAGTTCCCTCGGGCCCCAGCTCCGCCTCTGCCAGGTGTCTGGGCTGTTGGCCCTGCGGCCAGGGTCCTCCCTGCGGATCCGCACCCTCCCCTGGGCCCATCTCAAGGCTGCCCCCTTCCTCACCTACTTCGGACTCTTCCAGGTTCACTGA |
ORF Protein Sequence | MAARRSQRRRGRRGEPGTALLVPLALGLGLALACLGLLLAVVSLGSRASLSAQEPAQEELVAEEDQDPSELNPQTEESQDPAPFLNRLVRPRRSAPKGRKTRARRAIAAHYEVHPRPGQDGAQAGVDGTVSGWEEARINSSSPLRYNRQIGEFIVTRAGLYYLYCQVHFDEGKAVYLKLDLLVDGVLALRCLEEFSATAASSLGPQLRLCQVSGLLALRPGSSLRIRTLPWAHLKAAPFLTYFGLFQVH |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Target Antibody | GM-Tg-g-T46524-Ab | Anti-TNF12/ TWEAK/ TNFSF12 monoclonal antibody |
Target Antigen | GM-Tg-g-T46524-Ag | TWEAK/TNFSF12 VLP (virus-like particle) |
Cytokine | cks-Tg-g-GM-T46524 | Tumor necrosis factor superfamily member 12 (TNFSF12) protein & antibody |
ORF Viral Vector | pGMLP002011 | Human TNFSF12 Lentivirus plasmid |
ORF Viral Vector | vGMLP002011 | Human TNFSF12 Lentivirus particle |
Target information
Target ID | GM-T46524 |
Target Name | TNFSF12/TWEAK |
Gene Group Identifier (Target Gene ID in Homo species) |
8742 |
Gene ID |
100061872 (Equus caballus), 100551513 (Bos taurus), 100568280 (Canis lupus familiaris), 101098755 (Felis catus) 21944 (Mus musculus), 360548 (Rattus norvegicus), 8742 (Homo sapiens) |
Gene Symbols & Synonyms | TNFSF12,LOC101098755,Tnfsf12,TNLG4A,TWEAK,Dr3l,Apo3l,Dr3lg,Tweak,Tnlg4a,APO3L,DR3LG |
Target Alternative Names | TNFSF12, TWEAK,Tumor necrosis factor ligand superfamily member 12,APO3 ligand, TNF-related weak inducer of apoptosis (TWEAK),APO3L,DR3LG,TWEAK,TNLG4A |
Uniprot Accession |
O43508,O54907
Additional SwissProt Accessions: O54907,O43508 |
Uniprot Entry Name | |
Protein Sub-location | Transmembrane Protein |
Category | Therapeutics Target, Cytokine Target |
Disease | Prostate Cancer |
Disease from KEGG | Cytokine-cytokine receptor interaction |
Gene Ensembl | ENSECAG00000059252, ENSBTAG00000031725, ENSMUSG00000097328, ENSG00000239697 |
Target Classification |
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.