Human TIMP2/CSC-21K/DDC8 ORF/cDNA clone-Lentivirus particle (NM_003255.4)

Cat. No.: vGMLP002009

Pre-made Human TIMP2/CSC-21K/DDC8 Lentiviral expression plasmid for TIMP2 lentivirus packaging, TIMP2 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to TIMP2/CSC-21K products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

pdf MSDS
pdf Datasheet

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP002009 Human TIMP2 Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP002009
Gene Name TIMP2
Accession Number NM_003255.4
Gene ID 7077
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 663 bp
Gene Alias CSC-21K,DDC8
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGGCGCCGCGGCCCGCACCCTGCGGCTGGCGCTCGGCCTCCTGCTGCTGGCGACGCTGCTTCGCCCGGCCGACGCCTGCAGCTGCTCCCCGGTGCACCCGCAACAGGCGTTTTGCAATGCAGATGTAGTGATCAGGGCCAAAGCGGTCAGTGAGAAGGAAGTGGACTCTGGAAACGACATTTATGGCAACCCTATCAAGAGGATCCAGTATGAGATCAAGCAGATAAAGATGTTCAAAGGGCCTGAGAAGGATATAGAGTTTATCTACACGGCCCCCTCCTCGGCAGTGTGTGGGGTCTCGCTGGACGTTGGAGGAAAGAAGGAATATCTCATTGCAGGAAAGGCCGAGGGGGACGGCAAGATGCACATCACCCTCTGTGACTTCATCGTGCCCTGGGACACCCTGAGCACCACCCAGAAGAAGAGCCTGAACCACAGGTACCAGATGGGCTGCGAGTGCAAGATCACGCGCTGCCCCATGATCCCGTGCTACATCTCCTCCCCGGACGAGTGCCTCTGGATGGACTGGGTCACAGAGAAGAACATCAACGGGCACCAGGCCAAGTTCTTCGCCTGCATCAAGAGAAGTGACGGCTCCTGTGCGTGGTACCGCGGCGCGGCGCCCCCCAAGCAGGAGTTTCTCGACATCGAGGACCCATAA
ORF Protein Sequence MGAAARTLRLALGLLLLATLLRPADACSCSPVHPQQAFCNADVVIRAKAVSEKEVDSGNDIYGNPIKRIQYEIKQIKMFKGPEKDIEFIYTAPSSAVCGVSLDVGGKKEYLIAGKAEGDGKMHITLCDFIVPWDTLSTTQKKSLNHRYQMGCECKITRCPMIPCYISSPDECLWMDWVTEKNINGHQAKFFACIKRSDGSCAWYRGAAPPKQEFLDIEDP

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-SE1338-Ab Anti-TIMP2/ CSC-21K/ DDC8 functional antibody
    Target Antigen GM-Tg-g-SE1338-Ag TIMP2 protein
    ORF Viral Vector pGMLP002009 Human TIMP2 Lentivirus plasmid
    ORF Viral Vector vGMLP002009 Human TIMP2 Lentivirus particle


    Target information

    Target ID GM-SE1338
    Target Name TIMP2
    Gene Group Identifier
    （Target Gene ID in Homo species)         		7077
    Gene ID 100034134 (Equus caballus), 101083125 (Felis catus), 21858 (Mus musculus), 282093 (Bos taurus)
    29543 (Rattus norvegicus), 403633 (Canis lupus familiaris), 574357 (Macaca mulatta), 7077 (Homo sapiens)
    Gene Symbols & Synonyms TIMP2,Timp2,TIMP-2,Timp-2,D11Bwg1104e,DDC8,CSC-21K
    Target Alternative Names CSC-21K,D11Bwg1104e,DDC8,Metalloproteinase inhibitor 2,TIMP-2,TIMP2,Timp-2,Timp2,Tissue inhibitor of metalloproteinases 2 (TIMP-2)
    Uniprot Accession O77717,P16035,P16368,P25785,P30121,Q9TTY1
    Additional SwissProt Accessions: O77717,P25785,P16368,P30121,Q9TTY1,P16035
    Uniprot Entry Name
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category
    Disease cancer, Acute kidney failure, Dent disease, Malignant neoplasm of bladder
    Disease from KEGG
    Gene Ensembl ENSECAG00000060149, ENSMUSG00000017466, ENSBTAG00000010899, ENSG00000035862
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.