Human Nedd8/NEDD-8 ORF/cDNA clone-Lentivirus particle (NM_006156.2)

Cat. No.: vGMLP001974

Pre-made Human Nedd8/NEDD-8 Lentiviral expression plasmid for Nedd8 lentivirus packaging, Nedd8 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to NEDD8/Nedd8/NEDD-8 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

pdf MSDS
pdf Datasheet

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP001974 Human Nedd8 Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP001974
Gene Name Nedd8
Accession Number NM_006156.2
Gene ID 4738
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 246 bp
Gene Alias NEDD-8
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGCTAATTAAAGTGAAGACGCTGACCGGAAAGGAGATTGAGATTGACATTGAACCTACAGACAAGGTGGAGCGAATCAAGGAGCGTGTGGAGGAGAAAGAGGGAATCCCCCCACAACAGCAGAGGCTCATCTACAGTGGCAAGCAGATGAATGATGAGAAGACAGCAGCTGATTACAAGATTTTAGGTGGTTCAGTCCTTCACCTGGTGTTGGCTCTGAGAGGAGGAGGTGGTCTTAGGCAGTGA
ORF Protein Sequence MLIKVKTLTGKEIEIDIEPTDKVERIKERVEEKEGIPPQQQRLIYSGKQMNDEKTAADYKILGGSVLHLVLALRGGGGLRQ

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T93995-Ab Anti-NEDD8 monoclonal antibody
    Target Antigen GM-Tg-g-T93995-Ag NEDD8 protein
    ORF Viral Vector pGMLP001974 Human Nedd8 Lentivirus plasmid
    ORF Viral Vector vGMLP001974 Human Nedd8 Lentivirus particle


    Target information

    Target ID GM-T93995
    Target Name NEDD8
    Gene Group Identifier
    （Target Gene ID in Homo species)         		4738
    Gene ID 100051307 (Equus caballus), 101080973 (Felis catus), 18002 (Mus musculus), 25490 (Rattus norvegicus)
    286796 (Bos taurus), 4738 (Homo sapiens), 480265 (Canis lupus familiaris), 715763 (Macaca mulatta)
    Gene Symbols & Synonyms NEDD8,Nedd8,Rub1,NEDD-8,CDK8
    Target Alternative Names CDK8,NEDD-8,NEDD8,Nedd8,Neddylin,Neural precursor cell expressed developmentally down-regulated protein 8 (NEDD-8),Rub1,Ubiquitin-like protein NEDD8
    Uniprot Accession P29595,P61282,Q15843,Q71UE8
    Additional SwissProt Accessions: P29595,Q71UE8,P61282,Q15843
    Uniprot Entry Name
    Protein Sub-location Introcelluar Protein
    Category Therapeutics Target
    Disease
    Disease from KEGG
    Gene Ensembl ENSECAG00000028965, ENSMUSG00000010376, ENSG00000129559, ENSCAFG00845006300
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.