Human NMS ORF/cDNA clone-Lentivirus particle (NM_001011717)

Cat. No.: vGMLP001873

Pre-made Human NMS/ Lentiviral expression plasmid for NMS lentivirus packaging, NMS lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to NMS products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP001873 Human NMS Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP001873
Gene Name NMS
Accession Number NM_001011717
Gene ID 129521
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 462 bp
Gene Alias
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGAAACATCTTCGTCCCCAGTTCCCTCTCATCTTGGCCATCTACTGCTTCTGCATGCTACAGATTCCCTCCTCAGGATTTCCTCAACCTTTAGCTGATCCTTCAGATGGCTTGGATATTGTGCAGCTTGAGCAGCTGGCATATTGTCTGAGTCAGTGGGCACCTCTTTCTCGCCAACCTAAGGATAATCAAGACATATACAAAAGGTTTTTGTTTCACTACTCCAGAACTCAGGAGGCAACACATCCAGTTAAAACTGGGTTTCCTCCAGTGCATCCTCTAATGCACCTGGCTGCCAAGCTCGCCAACAGGCGGATGAAGAGAATTCTGCAGCGAGGCTCGGGGACTGCTGCAGTGGACTTCACCAAGAAGGATCACACTGCGACCTGGGGACGACCCTTTTTCCTTTTCAGGCCCAGGAATGGAAGAAACATTGAAGATGAGGCCCAGATTCAGTGGTGA
ORF Protein Sequence MKHLRPQFPLILAIYCFCMLQIPSSGFPQPLADPSDGLDIVQLEQLAYCLSQWAPLSRQPKDNQDIYKRFLFHYSRTQEATHPVKTGFPPVHPLMHLAAKLANRRMKRILQRGSGTAAVDFTKKDHTATWGRPFFLFRPRNGRNIEDEAQIQW

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-SE1127-Ab Anti-NMS functional antibody
    Target Antigen GM-Tg-g-SE1127-Ag NMS protein
    ORF Viral Vector pGMLP001873 Human NMS Lentivirus plasmid
    ORF Viral Vector vGMLP001873 Human NMS Lentivirus particle


    Target information

    Target ID GM-SE1127
    Target Name NMS
    Gene Group Identifier
    (Target Gene ID in Homo species)
    129521
    Gene ID 100630166 (Equus caballus), 101086135 (Felis catus), 129521 (Homo sapiens), 433292 (Mus musculus)
    474554 (Canis lupus familiaris), 497196 (Rattus norvegicus), 710021 (Macaca mulatta), 768331 (Bos taurus)
    Gene Symbols & Synonyms NMS,Nms
    Target Alternative Names NMS,Neuromedin-S
    Uniprot Accession Q0VBW8,Q5H8A1,Q5H8A2,Q5H8A3
    Additional SwissProt Accessions: Q5H8A3,Q5H8A1,Q5H8A2,Q0VBW8
    Uniprot Entry Name
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category
    Disease
    Disease from KEGG Neuroactive ligand-receptor interaction
    Gene Ensembl ENSECAG00000017654, ENSG00000204640, ENSMUSG00000067604, ENSCAFG00845016126, ENSMMUG00000030707, ENSBTAG00000034184
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.