Human FGF20/FGF-20/RHDA2 ORF/cDNA clone-Lentivirus particle (NM_019851)

Cat. No.: vGMLP001865

Pre-made Human FGF20/FGF-20/RHDA2 Lentiviral expression plasmid for FGF20 lentivirus packaging, FGF20 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to FGF20/FGF-20 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

pdf MSDS
pdf Datasheet

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP001865 Human FGF20 Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP001865
Gene Name FGF20
Accession Number NM_019851
Gene ID 26281
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 636 bp
Gene Alias FGF-20,RHDA2
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCTCCCTTAGCCGAAGTCGGGGGCTTTCTGGGCGGCCTGGAGGGCTTGGGCCAGCAGGTGGGTTCGCATTTCCTGTTGCCTCCTGCCGGGGAGCGGCCGCCGCTGCTGGGCGAGCGCAGGAGCGCGGCGGAGCGGAGCGCGCGCGGCGGGCCGGGGGCTGCGCAGCTGGCGCACCTGCACGGCATCCTGCGCCGCCGGCAGCTCTATTGCCGCACCGGCTTCCACCTGCAGATCCTGCCCGACGGCAGCGTGCAGGGCACCCGGCAGGACCACAGCCTCTTCGGTATCTTGGAATTCATCAGTGTGGCAGTGGGACTGGTCAGTATTAGAGGTGTGGACAGTGGTCTCTATCTTGGAATGAATGACAAAGGAGAACTCTATGGATCAGAGAAACTTACTTCCGAATGCATCTTTAGGGAGCAGTTTGAAGAGAACTGGTATAACACCTATTCATCTAACATATATAAACATGGAGACACTGGCCGCAGGTATTTTGTGGCACTTAACAAAGACGGAACTCCAAGAGATGGCGCCAGGTCCAAGAGGCATCAGAAATTTACACATTTCTTACCTAGACCAGTGGATCCAGAAAGAGTTCCAGAATTGTACAAGGACCTACTGATGTACACTTGA
ORF Protein Sequence MAPLAEVGGFLGGLEGLGQQVGSHFLLPPAGERPPLLGERRSAAERSARGGPGAAQLAHLHGILRRRQLYCRTGFHLQILPDGSVQGTRQDHSLFGILEFISVAVGLVSIRGVDSGLYLGMNDKGELYGSEKLTSECIFREQFEENWYNTYSSNIYKHGDTGRRYFVALNKDGTPRDGARSKRHQKFTHFLPRPVDPERVPELYKDLLMYT

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-SE0919-Ab Anti-FGF20/ FGF-20/ RHDA2 functional antibody
    Target Antigen GM-Tg-g-SE0919-Ag FGF20 protein
    Cytokine cks-Tg-g-GM-SE0919 fibroblast growth factor 20 (FGF20) protein & antibody
    ORF Viral Vector pGMLP001865 Human FGF20 Lentivirus plasmid
    ORF Viral Vector vGMLP001865 Human FGF20 Lentivirus particle


    Target information

    Target ID GM-SE0919
    Target Name FGF20
    Gene Group Identifier
    （Target Gene ID in Homo species)         		26281
    Gene ID 100050037 (Equus caballus), 100855820 (Canis lupus familiaris), 101083766 (Felis catus), 26281 (Homo sapiens)
    539083 (Bos taurus), 66017 (Rattus norvegicus), 701847 (Macaca mulatta), 80857 (Mus musculus)
    Gene Symbols & Synonyms FGF20,Fgf20,RHDA2,FGF-20,FGF4A,Fgf4a
    Target Alternative Names FGF-20,FGF20,FGF4A,Fgf20,Fgf4a,Fibroblast growth factor 20,RHDA2
    Uniprot Accession Q9ESL9,Q9EST9,Q9NP95
    Additional SwissProt Accessions: Q9NP95,Q9EST9,Q9ESL9
    Uniprot Entry Name
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Cytokine Target
    Disease
    Disease from KEGG MAPK signaling pathway, Ras signaling pathway, Rap1 signaling pathway, Calcium signaling pathway, PI3K-Akt signaling pathway, Regulation of actin cytoskeleton, Pathways in cancer, Chemical carcinogenesis - receptor activation, Melanoma, Breast cancer, Gastric cancer
    Gene Ensembl ENSECAG00000035169, ENSCAFG00845014402, ENSG00000078579, ENSBTAG00000044043, ENSMMUG00000062368, ENSMUSG00000031603
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.