Human PLA2G5/FRFB/GV-PLA2 ORF/cDNA clone-Lentivirus particle (NM_000929)
Cat. No.: vGMLP001831
Pre-made Human PLA2G5/FRFB/GV-PLA2 Lentiviral expression plasmid for PLA2G5 lentivirus packaging, PLA2G5 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.
Go to
PLA2G5/FRFB products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
| Catalog No. | Product Name | lentivirus Grade | lentivirus quantity |
|---|---|---|---|
| vGMLP001831 | Human PLA2G5 Lentivirus particle | Pilot Grade | 1.0E+8TU |
| 5.0E+8TU | |||
| 1.0E+9TU | |||
| Research Grade | 1.0E+8TU | ||
| 5.0E+8TU | |||
| 1.0E+9TU | |||
| GMP-like Grade | inquiry | ||
| GMP Grade | inquiry |
Product Description
| Catalog ID | vGMLP001831 |
| Gene Name | PLA2G5 |
| Accession Number | NM_000929 |
| Gene ID | 5322 |
| Species | Human |
| Product Type | Lentivirus particle (overexpression) |
| Insert Length | 417 bp |
| Gene Alias | FRFB,GV-PLA2,hVPLA(2),PLA2-10 |
| Fluorescent Reporter | ZsGreen |
| Mammalian Cell Selection | Puromyocin |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | CMV |
| Resistance | Amplicin |
| ORF Nucleotide Sequence | ATGAAAGGCCTCCTCCCACTGGCTTGGTTCCTGGCTTGTAGTGTGCCTGCTGTGCAAGGAGGCTTGCTGGACCTAAAATCAATGATCGAGAAGGTGACAGGGAAGAACGCCCTGACAAACTACGGCTTCTACGGCTGTTACTGCGGCTGGGGCGGCCGAGGAACCCCCAAGGATGGCACCGATTGGTGCTGTTGGGCGCATGACCACTGCTATGGGCGGCTGGAGGAGAAGGGCTGCAACATTCGCACACAGTCCTACAAATACAGATTCGCGTGGGGCGTGGTCACCTGCGAGCCCGGGCCCTTCTGCCATGTGAACCTCTGTGCCTGTGACCGGAAGCTCGTCTACTGCCTCAAGAGAAACCTACGGAGCTACAACCCACAGTACCAATACTTTCCCAACATCCTCTGCTCCTAG |
| ORF Protein Sequence | MKGLLPLAWFLACSVPAVQGGLLDLKSMIEKVTGKNALTNYGFYGCYCGWGGRGTPKDGTDWCCWAHDHCYGRLEEKGCNIRTQSYKYRFAWGVVTCEPGPFCHVNLCACDRKLVYCLKRNLRSYNPQYQYFPNILCS |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-MP2560-Ab | Anti-PA2G5/ PLA2G5/ FRFB monoclonal antibody |
| Target Antigen | GM-Tg-g-MP2560-Ag | PLA2G5 VLP (virus-like particle) |
| ORF Viral Vector | pGMLP001831 | Human PLA2G5 Lentivirus plasmid |
| ORF Viral Vector | vGMLP001831 | Human PLA2G5 Lentivirus particle |
Target information
| Target ID | GM-MP2560 |
| Target Name | PLA2G5 |
|
Gene Group Identifier (Target Gene ID in Homo species) |
5322 |
| Gene ID |
100058536 (Equus caballus), 101091796 (Felis catus), 29354 (Rattus norvegicus), 5322 (Homo sapiens) 614911 (Bos taurus), 704629 (Macaca mulatta) |
| Gene Symbols & Synonyms | PLA2G5,Pla2g5,PLA2-10,FRFB,GV-PLA2,hVPLA(2) |
| Target Alternative Names | FRFB,GV-PLA2,PLA2-10,PLA2G5,Phosphatidylcholine 2-acylhydrolase 5,Phospholipase A2 group V,Pla2g5,hVPLA(2) |
| Uniprot Accession |
P39877,P51433
Additional SwissProt Accessions: P51433,P39877 |
| Uniprot Entry Name | |
| Protein Sub-location | Transmembrane Protein |
| Category | |
| Disease | |
| Disease from KEGG | Metabolic pathways, Ras signaling pathway, Vascular smooth muscle contraction, Pancreatic secretion, Fat digestion and absorption, Glycerophospholipid metabolism, Ether lipid metabolism, Arachidonic acid metabolism, Linoleic acid metabolism |
| Gene Ensembl | ENSECAG00000006879, ENSG00000127472, ENSBTAG00000039122, ENSMMUG00000064805 |
| Target Classification |
About GMVC

GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.


