Human Nrtn/NTN ORF/cDNA clone-Lentivirus particle (NM_004558)

Cat. No.: vGMLP001825

Pre-made Human Nrtn/NTN Lentiviral expression plasmid for Nrtn lentivirus packaging, Nrtn lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to Neurturin/NRTN/Nrtn/NTN products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP001825 Human Nrtn Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP001825
Gene Name Nrtn
Accession Number NM_004558
Gene ID 4902
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 594 bp
Gene Alias NTN
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGCAGCGCTGGAAGGCGGCGGCCTTGGCCTCAGTGCTCTGCAGCTCCGTGCTGTCCATCTGGATGTGTCGAGAGGGCCTGCTTCTCAGCCACCGCCTCGGACCTGCGCTGGTCCCCCTGCACCGCCTGCCTCGAACCCTGGACGCCCGGATTGCCCGCCTGGCCCAGTACCGTGCACTCCTGCAGGGGGCCCCGGATGCGATGGAGCTGCGCGAGCTGACGCCCTGGGCTGGGCGGCCCCCAGGTCCGCGCCGTCGGGCGGGGCCCCGGCGGCGGCGCGCGCGTGCGCGGTTGGGGGCGCGGCCTTGCGGGCTGCGCGAGCTGGAGGTGCGCGTGAGCGAGCTGGGCCTGGGCTACGCGTCCGACGAGACGGTGCTGTTCCGCTACTGCGCAGGCGCCTGCGAGGCTGCCGCGCGCGTCTACGACCTCGGGCTGCGACGACTGCGCCAGCGGCGGCGCCTGCGGCGGGAGCGGGTGCGCGCGCAGCCCTGCTGCCGCCCGACGGCCTACGAGGACGAGGTGTCCTTCCTGGACGCGCACAGCCGCTACCACACGGTGCACGAGCTGTCGGCGCGCGAGTGCGCCTGCGTGTGA
ORF Protein Sequence MQRWKAAALASVLCSSVLSIWMCREGLLLSHRLGPALVPLHRLPRTLDARIARLAQYRALLQGAPDAMELRELTPWAGRPPGPRRRAGPRRRRARARLGARPCGLRELEVRVSELGLGYASDETVLFRYCAGACEAAARVYDLGLRRLRQRRRLRRERVRAQPCCRPTAYEDEVSFLDAHSRYHTVHELSARECACV

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-SE1137-Ab Anti-NRTN/ NTN functional antibody
    Target Antigen GM-Tg-g-SE1137-Ag NRTN protein
    Cytokine cks-Tg-g-GM-SE1137 neurturin (NRTN) protein & antibody
    ORF Viral Vector pGMLP001825 Human Nrtn Lentivirus plasmid
    ORF Viral Vector vGMLP001825 Human Nrtn Lentivirus particle


    Target information

    Target ID GM-SE1137
    Target Name Neurturin/NRTN
    Gene Group Identifier
    (Target Gene ID in Homo species)
    4902
    Gene ID 109493852 (Felis catus), 111774192 (Equus caballus), 18188 (Mus musculus), 4902 (Homo sapiens)
    525562 (Bos taurus), 697336 (Macaca mulatta), 84423 (Rattus norvegicus)
    Gene Symbols & Synonyms NRTN,Nrtn,NTN
    Target Alternative Names Neurturin, NRTN,Neurturin,NTN
    Uniprot Accession P97463,Q99748
    Additional SwissProt Accessions: P97463,Q99748
    Uniprot Entry Name
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Cytokine Target
    Disease
    Disease from KEGG
    Gene Ensembl ENSECAG00000039189, ENSMUSG00000039481, ENSG00000171119, ENSBTAG00000000413, ENSMMUG00000058031
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.