Click here to discover the largest collection of GeneMedi's Promise-ORF™ ORF/cDNA expression clones
- • Up to 20%-50%* off first purchase
- • Bulk quantities available
- • Citation Reward application
TECHNICAL RESOURCE
Supports
- Talk to our Expert:
[email protected]
Protocol Library Download
 |
 |
Human GDF1/DORV/DTGA3 ORF/cDNA clone-Lentivirus particle (NM_001492)
Cat. No.: vGMLP001652
Pre-made Human GDF1/DORV/DTGA3 Lentiviral expression plasmid for GDF1 lentivirus packaging, GDF1 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.
Go to
GDF1/DORV products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
MSDS
| Catalog No. | Product Name | lentivirus Grade | lentivirus quantity |
|---|---|---|---|
| vGMLP001652 | Human GDF1 Lentivirus particle | Pilot Grade | 1.0E+8TU |
| 5.0E+8TU | |||
| 1.0E+9TU | |||
| Research Grade | 1.0E+8TU | ||
| 5.0E+8TU | |||
| 1.0E+9TU | |||
| GMP-like Grade | inquiry | ||
| GMP Grade | inquiry |
Product Description
| Catalog ID | vGMLP001652 |
| Gene Name | GDF1 |
| Accession Number | NM_001492 |
| Gene ID | 2657 |
| Species | Human |
| Product Type | Lentivirus particle (overexpression) |
| Insert Length | 1119 bp |
| Gene Alias | DORV,DTGA3,RAI |
| Fluorescent Reporter | ZsGreen |
| Mammalian Cell Selection | Puromyocin |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | CMV |
| Resistance | Amplicin |
| ORF Nucleotide Sequence | ATGCCACCGCCGCAGCAAGGTCCCTGCGGCCACCACCTCCTCCTCCTCCTGGCCCTGCTGCTGCCCTCGCTGCCCCTGACCCGCGCCCCCGTGCCCCCAGGCCCAGCCGCCGCCCTGCTCCAGGCTCTAGGACTGCGCGATGAGCCCCAGGGTGCCCCCAGGCTCCGGCCGGTTCCCCCGGTCATGTGGCGCCTGTTTCGACGCCGGGACCCCCAGGAGACCAGGTCTGGCTCGCGGCGGACGTCCCCAGGGGTCACCCTGCAACCGTGCCACGTGGAGGAGCTGGGGGTCGCCGGAAACATCGTGCGCCACATCCCGGACCGCGGTGCGCCCACCCGGGCCTCGGAGCCTGCCTCGGCCGCGGGGCATTGCCCTGAGTGGACAGTCGTCTTCGACCTGTCGGCTGTGGAACCCGCTGAGCGCCCGAGCCGGGCCCGCCTGGAGCTGCGTTTCGCGGCGGCGGCGGCGGCAGCCCCGGAGGGCGGCTGGGAGCTGAGCGTGGCGCAAGCGGGCCAGGGCGCGGGCGCGGACCCCGGGCCGGTGCTGCTCCGCCAGTTGGTGCCCGCCCTGGGGCCGCCAGTGCGCGCGGAGCTGCTGGGCGCCGCTTGGGCTCGCAACGCCTCATGGCCGCGCAGCCTCCGCCTGGCGCTGGCGCTACGCCCCCGGGCCCCTGCCGCCTGCGCGCGCCTGGCCGAGGCCTCGCTGCTGCTGGTGACCCTCGACCCGCGCCTGTGCCACCCCCTGGCCCGGCCGCGGCGCGACGCCGAACCCGTGTTGGGCGGCGGCCCCGGGGGCGCTTGTCGCGCGCGGCGGCTGTACGTGAGCTTCCGCGAGGTGGGCTGGCACCGCTGGGTCATCGCGCCGCGCGGCTTCCTGGCCAACTACTGCCAGGGTCAGTGCGCGCTGCCCGTCGCGCTGTCGGGGTCCGGGGGGCCGCCGGCGCTCAACCACGCTGTGCTGCGCGCGCTCATGCACGCGGCCGCCCCGGGAGCCGCCGACCTGCCCTGCTGCGTGCCCGCGCGCCTGTCGCCCATCTCCGTGCTCTTCTTTGACAACAGCGACAACGTGGTGCTGCGGCAGTATGAGGACATGGTGGTGGACGAGTGCGGCTGCCGCTAA |
| ORF Protein Sequence | MPPPQQGPCGHHLLLLLALLLPSLPLTRAPVPPGPAAALLQALGLRDEPQGAPRLRPVPPVMWRLFRRRDPQETRSGSRRTSPGVTLQPCHVEELGVAGNIVRHIPDRGAPTRASEPASAAGHCPEWTVVFDLSAVEPAERPSRARLELRFAAAAAAAPEGGWELSVAQAGQGAGADPGPVLLRQLVPALGPPVRAELLGAAWARNASWPRSLRLALALRPRAPAACARLAEASLLLVTLDPRLCHPLARPRRDAEPVLGGGPGGACRARRLYVSFREVGWHRWVIAPRGFLANYCQGQCALPVALSGSGGPPALNHAVLRALMHAAAPGAADLPCCVPARLSPISVLFFDNSDNVVLRQYEDMVVDECGCR |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-SE0938-Ab | Anti-GDF1/ CERS1/ CHTD6 functional antibody |
| Target Antigen | GM-Tg-g-SE0938-Ag | GDF1 protein |
| Cytokine | cks-Tg-g-GM-SE0938 | growth differentiation factor 1 (GDF1) protein & antibody |
| ORF Viral Vector | pGMLP001652 | Human GDF1 Lentivirus plasmid |
| ORF Viral Vector | vGMLP001652 | Human GDF1 Lentivirus particle |
Target information
| Target ID | GM-SE0938 |
| Target Name | GDF1 |
|
Gene Group Identifier （Target Gene ID in Homo species) |
2657 |
| Gene ID |
100686938 (Canis lupus familiaris), 101096297 (Felis catus), 104968455 (Bos taurus), 111769683 (Equus caballus) 14559 (Mus musculus), 2657 (Homo sapiens), 306351 (Rattus norvegicus), 720298 (Macaca mulatta) |
| Gene Symbols & Synonyms | GDF1,Gdf1,Gdf-1,RAI,DORV,LAG1,UOG1,CERS1,CHTD6,DTGA3,LASS1 |
| Target Alternative Names | CERS1,CHTD6,DORV,DTGA3,Embryonic growth/differentiation factor 1,GDF-1,GDF1,Gdf-1,Gdf1,LAG1,LASS1,RAI,UOG1 |
| Uniprot Accession |
P20863,P27539
Additional SwissProt Accessions: P20863,P27539 |
| Uniprot Entry Name | |
| Protein Sub-location | Secreted Protein/Potential Cytokines |
| Category | Cytokine Target |
| Disease | |
| Disease from KEGG | Cytokine-cytokine receptor interaction |
| Gene Ensembl | ENSCAFG00845019828, ENSBTAG00000020923, ENSMUSG00000087408,ENSMUSG00000109523, ENSG00000130283, ENSMMUG00000023290 |
| Target Classification |
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.