Human EFNA1/B61/ECKLG ORF/cDNA clone-Lentivirus particle (NM_004428)

Cat. No.: vGMLP001215

Pre-made Human EFNA1/B61/ECKLG Lentiviral expression plasmid for EFNA1 lentivirus packaging, EFNA1 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to EFNA1/B61 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

pdf MSDS
pdf Datasheet

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP001215 Human EFNA1 Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP001215
Gene Name EFNA1
Accession Number NM_004428
Gene ID 1942
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 618 bp
Gene Alias B61,ECKLG,EFL1,EPLG1,LERK-1,LERK1,TNFAIP4
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGAGTTCCTCTGGGCCCCTCTCTTGGGTCTGTGCTGCAGTCTGGCCGCTGCTGATCGCCACACCGTCTTCTGGAACAGTTCAAATCCCAAGTTCCGGAATGAGGACTACACCATACATGTGCAGCTGAATGACTACGTGGACATCATCTGTCCGCACTATGAAGATCACTCTGTGGCAGACGCTGCCATGGAGCAGTACATACTGTACCTGGTGGAGCATGAGGAGTACCAGCTGTGCCAGCCCCAGTCCAAGGACCAAGTCCGCTGGCAGTGCAACCGGCCCAGTGCCAAGCATGGCCCGGAGAAGCTGTCTGAGAAGTTCCAGCGCTTCACACCTTTCACCCTGGGCAAGGAGTTCAAAGAAGGACACAGCTACTACTACATCTCCAAACCCATCCACCAGCATGAAGACCGCTGCTTGAGGTTGAAGGTGACTGTCAGTGGCAAAATCACTCACAGTCCTCAGGCCCATGACAATCCACAGGAGAAGAGACTTGCAGCAGATGACCCAGAGGTGCGGGTTCTACATAGCATCGGTCACAGTGCTGCCCCACGCCTCTTCCCACTTGCCTGGACTGTGCTGCTCCTTCCACTTCTGCTGCTGCAAACCCCGTGA
ORF Protein Sequence MEFLWAPLLGLCCSLAAADRHTVFWNSSNPKFRNEDYTIHVQLNDYVDIICPHYEDHSVADAAMEQYILYLVEHEEYQLCQPQSKDQVRWQCNRPSAKHGPEKLSEKFQRFTPFTLGKEFKEGHSYYYISKPIHQHEDRCLRLKVTVSGKITHSPQAHDNPQEKRLAADDPEVRVLHSIGHSAAPRLFPLAWTVLLLPLLLLQTP

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-MP0392-Ab Anti-EFNA1/ B61/ ECKLG monoclonal antibody
    Target Antigen GM-Tg-g-MP0392-Ag EFNA1 VLP (virus-like particle)
    ORF Viral Vector pGMLP001215 Human EFNA1 Lentivirus plasmid
    ORF Viral Vector vGMLP001215 Human EFNA1 Lentivirus particle


    Target information

    Target ID GM-MP0392
    Target Name EFNA1
    Gene Group Identifier
    （Target Gene ID in Homo species)         		1942
    Gene ID 100063307 (Equus caballus), 101094570 (Felis catus), 13636 (Mus musculus), 1942 (Homo sapiens)
    490431 (Canis lupus familiaris), 507319 (Bos taurus), 717399 (Macaca mulatta), 94268 (Rattus norvegicus)
    Gene Symbols & Synonyms EFNA1,Efna1,B61,Efl1,Epl1,Eplg1,Lerk1,EFL1,GMAN,ECKLG,EPLG1,LERK1,LERK-1,TNFAIP4
    Target Alternative Names B61,ECKLG,EFL1,EFNA1,EPH-related receptor tyrosine kinase ligand 1 (LERK-1),EPLG1,Efl1,Efna1,Ephrin-A1,Epl1,Eplg1,GMAN,Immediate early response protein B61,LERK-1,LERK1,Lerk1,TNFAIP4,Tumor necrosis factor alpha-induced protein 4 (TNF alpha-induced protein 4)
    Uniprot Accession P20827,P52793,P97553,Q3ZC64
    Additional SwissProt Accessions: P52793,P20827,Q3ZC64,P97553
    Uniprot Entry Name
    Protein Sub-location Transmembrane Protein
    Category
    Disease
    Disease from KEGG MAPK signaling pathway, Ras signaling pathway, Rap1 signaling pathway, PI3K-Akt signaling pathway, Axon guidance
    Gene Ensembl ENSMUSG00000027954, ENSG00000169242, ENSCAFG00845013438, ENSBTAG00000020244, ENSMMUG00000005350
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.