Human EDN1/ARCND3/ET1 ORF/cDNA clone-Lentivirus particle (NM_001955)

Cat. No.: vGMLP001214

Pre-made Human EDN1/ARCND3/ET1 Lentiviral expression plasmid for EDN1 lentivirus packaging, EDN1 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to Endothelin 1/EDN1/EDN1/ARCND3 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP001214 Human EDN1 Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP001214
Gene Name EDN1
Accession Number NM_001955
Gene ID 1906
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 639 bp
Gene Alias ARCND3,ET1,HDLCQ7,PPET1,QME
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGATTATTTGCTCATGATTTTCTCTCTGCTGTTTGTGGCTTGCCAAGGAGCTCCAGAAACAGCAGTCTTAGGCGCTGAGCTCAGCGCGGTGGGTGAGAACGGCGGGGAGAAACCCACTCCCAGTCCACCCTGGCGGCTCCGCCGGTCCAAGCGCTGCTCCTGCTCGTCCCTGATGGATAAAGAGTGTGTCTACTTCTGCCACCTGGACATCATTTGGGTCAACACTCCCGAGCACGTTGTTCCGTATGGACTTGGAAGCCCTAGGTCCAAGAGAGCCTTGGAGAATTTACTTCCCACAAAGGCAACAGACCGTGAAAATAGATGCCAATGTGCTAGCCAAAAAGACAAGAAGTGCTGGAATTTTTGCCAAGCAGGAAAAGAACTCAGGGCTGAAGACATTATGGAGAAAGACTGGAATAATCATAAGAAAGGAAAAGACTGTTCCAAGCTTGGGAAAAAGTGTATTTATCAGCAGTTAGTGAGAGGAAGAAAAATCAGAAGAAGTTCAGAGGAACACCTAAGACAAACCAGGTCGGAGACCATGAGAAACAGCGTCAAATCATCTTTTCATGATCCCAAGCTGAAAGGCAAGCCCTCCAGAGAGCGTTATGTGACCCACAACCGAGCACATTGGTGA
ORF Protein Sequence MDYLLMIFSLLFVACQGAPETAVLGAELSAVGENGGEKPTPSPPWRLRRSKRCSCSSLMDKECVYFCHLDIIWVNTPEHVVPYGLGSPRSKRALENLLPTKATDRENRCQCASQKDKKCWNFCQAGKELRAEDIMEKDWNNHKKGKDCSKLGKKCIYQQLVRGRKIRRSSEEHLRQTRSETMRNSVKSSFHDPKLKGKPSRERYVTHNRAHW

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T25076-Ab Anti-EDN1/ ARCND3/ ET1 functional antibody
    Target Antigen GM-Tg-g-T25076-Ag EDN1 protein
    ORF Viral Vector pGMLP001214 Human EDN1 Lentivirus plasmid
    ORF Viral Vector vGMLP001214 Human EDN1 Lentivirus particle


    Target information

    Target ID GM-T25076
    Target Name Endothelin 1/EDN1
    Gene Group Identifier
    (Target Gene ID in Homo species)
    1906
    Gene ID 100034060 (Equus caballus), 13614 (Mus musculus), 1906 (Homo sapiens), 24323 (Rattus norvegicus)
    281137 (Bos taurus), 403424 (Canis lupus familiaris), 494214 (Felis catus), 699982 (Macaca mulatta)
    Gene Symbols & Synonyms EDN1,Edn1,ET-1,PPET1,preproET,ET1,QME,ARCND3,HDLCQ7,Et1
    Target Alternative Names ARCND3,EDN1,ET-1,ET1,Edn1,Endothelin 1,Endothelin-1,Et1,HDLCQ7,PPET1,Preproendothelin-1 (PPET1),QME,preproET
    Uniprot Accession P05305,P13206,P17322,P22387,P22388,Q5NRQ1
    Additional SwissProt Accessions: P22387,P05305,P22388,P17322,P13206,Q5NRQ1
    Uniprot Entry Name
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Therapeutics Target
    Disease
    Disease from KEGG cAMP signaling pathway, HIF-1 signaling pathway, Neuroactive ligand-receptor interaction, Vascular smooth muscle contraction, TNF signaling pathway, Melanogenesis, Renin secretion, Relaxin signaling pathway, AGE-RAGE signaling pathway in diabetic complications, Pathways in cancer, Hypertrophic cardiomyopathy, Fluid shear stress and atherosclerosis
    Gene Ensembl ENSECAG00000011618, ENSMUSG00000021367, ENSG00000078401, ENSBTAG00000008096, ENSCAFG00845021350, ENSMMUG00000051532
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.