Human SCG5/7B2/P7B2 ORF/cDNA clone-Lentivirus particle (NM_003020.4)

Cat. No.: vGMLP001208

Pre-made Human SCG5/7B2/P7B2 Lentiviral expression plasmid for SCG5 lentivirus packaging, SCG5 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to Secretogranin V/SCG5/SCG5/7B2 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

pdf MSDS
pdf Datasheet

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP001208 Human SCG5 Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP001208
Gene Name SCG5
Accession Number NM_003020.4
Gene ID 6447
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 636 bp
Gene Alias 7B2,P7B2,SGNE1,SgV
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGTCTCCAGGATGGTCTCTACCATGCTATCTGGCCTACTGTTTTGGCTGGCATCTGGATGGACTCCAGCATTTGCTTACAGCCCCCGGACCCCTGACCGGGTCTCAGAAGCAGATATCCAGAGGCTGCTTCATGGTGTTATGGAGCAATTGGGCATTGCCAGGCCCCGAGTGGAATATCCAGCTCACCAGGCCATGAATCTTGTGGGCCCCCAGAGCATTGAAGGTGGAGCTCATGAAGGACTTCAGCATTTGGGTCCTTTTGGCAACATCCCCAACATCGTGGCAGAGTTGACTGGAGACAACATTCCTAAGGACTTTAGTGAGGATCAGGGGTACCCAGACCCTCCAAATCCCTGTCCTGTTGGAAAAACAGATGATGGATGTCTAGAAAACACCCCTGACACTGCAGAGTTCAGTCGAGAGTTCCAGTTGCACCAGCATCTCTTTGATCCGGAACATGACTATCCAGGCTTGGGCAAGTGGAACAAGAAACTCCTTTACGAGAAGATGAAGGGAGGAGAGAGACGAAAGCGGAGGAGTGTCAATCCATATCTACAAGGACAGAGACTGGATAATGTTGTTGCAAAGAAGTCTGTCCCCCATTTTTCAGATGAGGATAAGGATCCAGAGTAA
ORF Protein Sequence MVSRMVSTMLSGLLFWLASGWTPAFAYSPRTPDRVSEADIQRLLHGVMEQLGIARPRVEYPAHQAMNLVGPQSIEGGAHEGLQHLGPFGNIPNIVAELTGDNIPKDFSEDQGYPDPPNPCPVGKTDDGCLENTPDTAEFSREFQLHQHLFDPEHDYPGLGKWNKKLLYEKMKGGERRKRRSVNPYLQGQRLDNVVAKKSVPHFSDEDKDPE

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-SE1262-Ab Anti-7B2/ SCG5/ P7B2 functional antibody
    Target Antigen GM-Tg-g-SE1262-Ag SCG5 protein
    ORF Viral Vector pGMLP001208 Human SCG5 Lentivirus plasmid
    ORF Viral Vector vGMLP001208 Human SCG5 Lentivirus particle


    Target information

    Target ID GM-SE1262
    Target Name Secretogranin V/SCG5
    Gene Group Identifier
    （Target Gene ID in Homo species)         		6447
    Gene ID 100071769 (Equus caballus), 20394 (Mus musculus), 25719 (Rattus norvegicus), 478249 (Canis lupus familiaris)
    508224 (Bos taurus), 6447 (Homo sapiens), 694088 (Macaca mulatta)
    Gene Symbols & Synonyms SCG5,Scg5,7B2,Sgne1,Sgne-1,SgV,P7B2,SGNE1
    Target Alternative Names 7B2,Neuroendocrine protein 7B2,P7B2,Pituitary polypeptide,SCG5,SGNE1,Scg5,Secretogranin V,Secretogranin-5,Secretory granule endocrine protein I,SgV,Sgne-1,Sgne1
    Uniprot Accession P05408,P12961,P27682
    Additional SwissProt Accessions: P12961,P27682,P05408
    Uniprot Entry Name
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category
    Disease
    Disease from KEGG
    Gene Ensembl ENSECAG00000022874, ENSMUSG00000023236, ENSCAFG00845031115, ENSBTAG00000032613, ENSG00000166922, ENSMMUG00000012283
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.