Human ADM/AM/PAMP ORF/cDNA clone-Lentivirus particle (NM_001124)

Cat. No.: vGMLP001161

Pre-made Human ADM/AM/PAMP Lentiviral expression plasmid for ADM lentivirus packaging, ADM lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to Adrenomedullin/ADM/ADM/AM products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

pdf MSDS
pdf Datasheet

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP001161 Human ADM Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP001161
Gene Name ADM
Accession Number NM_001124
Gene ID 133
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 558 bp
Gene Alias AM,PAMP
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGAAGCTGGTTTCCGTCGCCCTGATGTACCTGGGTTCGCTCGCCTTCCTAGGCGCTGACACCGCTCGGTTGGATGTCGCGTCGGAGTTTCGAAAGAAGTGGAATAAGTGGGCTCTGAGTCGTGGGAAGAGGGAACTGCGGATGTCCAGCAGCTACCCCACCGGGCTCGCTGACGTGAAGGCCGGGCCTGCCCAGACCCTTATTCGGCCCCAGGACATGAAGGGTGCCTCTCGAAGCCCCGAAGACAGCAGTCCGGATGCCGCCCGCATCCGAGTCAAGCGCTACCGCCAGAGCATGAACAACTTCCAGGGCCTCCGGAGCTTTGGCTGCCGCTTCGGGACGTGCACGGTGCAGAAGCTGGCACACCAGATCTACCAGTTCACAGATAAGGACAAGGACAACGTCGCCCCCAGGAGCAAGATCAGCCCCCAGGGCTACGGCCGCCGGCGCCGGCGCTCCCTGCCCGAGGCCGGCCCGGGTCGGACTCTGGTGTCTTCTAAGCCACAAGCACACGGGGCTCCAGCCCCCCCGAGTGGAAGTGCTCCCCACTTTCTTTAG
ORF Protein Sequence MKLVSVALMYLGSLAFLGADTARLDVASEFRKKWNKWALSRGKRELRMSSSYPTGLADVKAGPAQTLIRPQDMKGASRSPEDSSPDAARIRVKRYRQSMNNFQGLRSFGCRFGTCTVQKLAHQIYQFTDKDKDNVAPRSKISPQGYGRRRRRSLPEAGPGRTLVSSKPQAHGAPAPPSGSAPHFL

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Biosimilar GMP-Bios-ab-183 Pre-Made Enibarcimab biosimilar, Whole mAb, Anti-ADM Antibody: Anti-AM/PAMP therapeutic antibody
    Target Antibody GM-Tg-g-T20629-Ab Anti-ADML/ ADM/ AM functional antibody
    Target Antigen GM-Tg-g-T20629-Ag ADM protein
    ORF Viral Vector pGMLP001161 Human ADM Lentivirus plasmid
    ORF Viral Vector vGMLP001161 Human ADM Lentivirus particle


    Target information

    Target ID GM-T20629
    Target Name Adrenomedullin/ADM
    Gene Group Identifier
    （Target Gene ID in Homo species)         		133
    Gene ID 100033857 (Equus caballus), 101087095 (Felis catus), 11535 (Mus musculus), 133 (Homo sapiens)
    25026 (Rattus norvegicus), 280713 (Bos taurus), 403817 (Canis lupus familiaris), 703305 (Macaca mulatta)
    Gene Symbols & Synonyms ADM,Adm,AMPP,AM,PAMP,Ap,RATAP,H39316
    Target Alternative Names ADM,AM,AMPP,Adm,Adrenomedullin,Ap,H39316,PAMP,Pro-adrenomedullin,RATAP
    Uniprot Accession O62827,O77559,P35318,P43145,P97297
    Additional SwissProt Accessions: P97297,P35318,P43145,O62827,O77559
    Uniprot Entry Name
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Therapeutics Target, INN Index
    Disease Acute tubulo-interstitial nephritis, lung cancer
    Disease from KEGG Neuroactive ligand-receptor interaction, Vascular smooth muscle contraction
    Gene Ensembl ENSMUSG00000030790, ENSG00000148926, ENSBTAG00000021048, ENSCAFG00845014478, ENSMMUG00000016387
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.