Human HSPB6/HEL55/Hsp20 ORF/cDNA clone-Lentivirus particle (NM_144617)

Cat. No.: vGMLP000971

Pre-made Human HSPB6/HEL55/Hsp20 Lentiviral expression plasmid for HSPB6 lentivirus packaging, HSPB6 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to HSP20/HSPB6/HSPB6/HEL55 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP000971 Human HSPB6 Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP000971
Gene Name HSPB6
Accession Number NM_144617
Gene ID 126393
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 483 bp
Gene Alias HEL55,Hsp20,PPP1R91
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGAGATCCCTGTGCCTGTGCAGCCGTCTTGGCTGCGCCGCGCCTCGGCCCCGTTGCCCGGACTTTCGGCGCCCGGACGCCTCTTTGACCAGCGCTTCGGCGAGGGGCTGCTGGAGGCCGAGCTGGCTGCGCTCTGCCCCACCACGCTCGCCCCCTACTACCTGCGCGCACCCAGCGTGGCGCTGCCCGTCGCCCAGGTGCCGACGGACCCCGGCCACTTTTCGGTGCTGCTAGACGTGAAGCACTTCTCGCCGGAGGAAATTGCTGTCAAGGTGGTGGGCGAACACGTGGAGGTGCACGCGCGCCACGAGGAGCGCCCGGATGAGCACGGATTCGTCGCGCGCGAGTTCCACCGTCGCTACCGCCTGCCGCCTGGCGTGGATCCGGCTGCCGTGACGTCCGCGCTGTCCCCCGAGGGCGTCCTGTCCATCCAGGCCGCACCAGCGTCGGCCCAGGCCCCACCGCCAGCCGCAGCCAAGTAG
ORF Protein Sequence MEIPVPVQPSWLRRASAPLPGLSAPGRLFDQRFGEGLLEAELAALCPTTLAPYYLRAPSVALPVAQVPTDPGHFSVLLDVKHFSPEEIAVKVVGEHVEVHARHEERPDEHGFVAREFHRRYRLPPGVDPAAVTSALSPEGVLSIQAAPASAQAPPPAAAK

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-SE1397-Ab Anti-HSPB6/ HEL55/ Hsp20 functional antibody
    Target Antigen GM-Tg-g-SE1397-Ag HSPB6 protein
    ORF Viral Vector pGMLP000971 Human HSPB6 Lentivirus plasmid
    ORF Viral Vector vGMLP000971 Human HSPB6 Lentivirus particle


    Target information

    Target ID GM-SE1397
    Target Name HSP20/HSPB6
    Gene Group Identifier
    (Target Gene ID in Homo species)
    126393
    Gene ID 100146605 (Equus caballus), 101098270 (Felis catus), 126393 (Homo sapiens), 192245 (Rattus norvegicus)
    243912 (Mus musculus), 484574 (Canis lupus familiaris), 534551 (Bos taurus), 710760 (Macaca mulatta)
    Gene Symbols & Synonyms HSPB6,Hspb6,HEL55,Hsp20,PPP1R91,p20,Gm479,HSP20
    Target Alternative Names Gm479,HEL55,HSP20,HSPB6,Heat shock 20 kDa-like protein p20,Heat shock protein beta-6,Heat shock protein family B member 6,Hsp20,HspB6,Hspb6,PPP1R91,p20
    Uniprot Accession O14558,P97541,Q148F8,Q5EBG6
    Additional SwissProt Accessions: O14558,P97541,Q5EBG6,Q148F8
    Uniprot Entry Name
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category
    Disease Prostate Cancer
    Disease from KEGG
    Gene Ensembl ENSECAG00000039018, ENSG00000004776, ENSMUSG00000036854, ENSCAFG00845001363, ENSBTAG00000018598, ENSMMUG00000002389
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.