Human VHL/HRCA1/pVHL ORF/cDNA clone-Lentivirus particle (NM_000551)

Cat. No.: vGMLP000945

Pre-made Human VHL/HRCA1/pVHL Lentiviral expression plasmid for VHL lentivirus packaging, VHL lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to VHL/HRCA1 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

pdf MSDS
pdf Datasheet

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP000945 Human VHL Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP000945
Gene Name VHL
Accession Number NM_000551
Gene ID 7428
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 642 bp
Gene Alias HRCA1,pVHL,RCA1,VHL1
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGCCCCGGAGGGCGGAGAACTGGGACGAGGCCGAGGTAGGCGCGGAGGAGGCAGGCGTCGAAGAGTACGGCCCTGAAGAAGACGGCGGGGAGGAGTCGGGCGCCGAGGAGTCCGGCCCGGAAGAGTCCGGCCCGGAGGAACTGGGCGCCGAGGAGGAGATGGAGGCCGGGCGGCCGCGGCCCGTGCTGCGCTCGGTGAACTCGCGCGAGCCCTCCCAGGTCATCTTCTGCAATCGCAGTCCGCGCGTCGTGCTGCCCGTATGGCTCAACTTCGACGGCGAGCCGCAGCCCTACCCAACGCTGCCGCCTGGCACGGGCCGCCGCATCCACAGCTACCGAGGTCACCTTTGGCTCTTCAGAGATGCAGGGACACACGATGGGCTTCTGGTTAACCAAACTGAATTATTTGTGCCATCTCTCAATGTTGACGGACAGCCTATTTTTGCCAATATCACACTGCCAGTGTATACTCTGAAAGAGCGATGCCTCCAGGTTGTCCGGAGCCTAGTCAAGCCTGAGAATTACAGGAGACTGGACATCGTCAGGTCGCTCTACGAAGATCTGGAAGACCACCCAAATGTGCAGAAAGACCTGGAGCGGCTGACACAGGAGCGCATTGCACATCAACGGATGGGAGATTGA
ORF Protein Sequence MPRRAENWDEAEVGAEEAGVEEYGPEEDGGEESGAEESGPEESGPEELGAEEEMEAGRPRPVLRSVNSREPSQVIFCNRSPRVVLPVWLNFDGEPQPYPTLPPGTGRRIHSYRGHLWLFRDAGTHDGLLVNQTELFVPSLNVDGQPIFANITLPVYTLKERCLQVVRSLVKPENYRRLDIVRSLYEDLEDHPNVQKDLERLTQERIAHQRMGD

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T80423-Ab Anti-VHL monoclonal antibody
    Target Antigen GM-Tg-g-T80423-Ag VHL protein
    ORF Viral Vector pGMLP000945 Human VHL Lentivirus plasmid
    ORF Viral Vector pGMPC000615 Human VHL Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector vGMLP000945 Human VHL Lentivirus particle


    Target information

    Target ID GM-T80423
    Target Name VHL
    Gene Group Identifier
    （Target Gene ID in Homo species)         		7428
    Gene ID 100058139 (Equus caballus), 101092590 (Felis catus), 106996285 (Macaca mulatta), 22346 (Mus musculus)
    24874 (Rattus norvegicus), 494000 (Canis lupus familiaris), 540957 (Bos taurus), 7428 (Homo sapiens)
    Gene Symbols & Synonyms VHL,Vhl,pVHL,Vhlh,RCA1,VHL1,HRCA1
    Target Alternative Names HRCA1,Protein G7,RCA1,VHL,VHL1,Vhl,Vhlh,pVHL,von Hippel-Lindau disease tumor suppressor
    Uniprot Accession P40337,P40338,Q5Q9Z2,Q64259
    Additional SwissProt Accessions: P40338,Q64259,Q5Q9Z2,P40337
    Uniprot Entry Name
    Protein Sub-location Introcelluar Protein
    Category Therapeutics Target
    Disease cancer
    Disease from KEGG HIF-1 signaling pathway, Pathways in cancer, Renal cell carcinoma
    Gene Ensembl ENSMMUG00000056789, ENSMUSG00000033933, ENSCAFG00845008162, ENSG00000134086
    Target Classification Tumor-associated antigen (TAA)


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.