Human FXYD2/ATP1G1/HOMG2 ORF/cDNA clone-Lentivirus particle (NM_001680)

Cat. No.: vGMLP000938

Pre-made Human FXYD2/ATP1G1/HOMG2 Lentiviral expression plasmid for FXYD2 lentivirus packaging, FXYD2 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to FXYD2/ATP1G1 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP000938 Human FXYD2 Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP000938
Gene Name FXYD2
Accession Number NM_001680
Gene ID 486
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 201 bp
Gene Alias ATP1G1,HOMG2
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGACTGGGTTGTCGATGGACGGTGGCGGCAGCCCCAAGGGGGACGTGGACCCGTTCTACTATGACTATGAGACCGTTCGCAATGGGGGCCTGATCTTCGCTGGACTGGCCTTCATCGTGGGGCTCCTCATCCTCCTCAGCAGAAGATTCCGCTGTGGGGGCAATAAGAAGCGCAGGCAAATCAATGAAGATGAGCCGTAA
ORF Protein Sequence MTGLSMDGGGSPKGDVDPFYYDYETVRNGGLIFAGLAFIVGLLILLSRRFRCGGNKKRRQINEDEP

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-MP0455-Ab Anti-ATNG/ FXYD2/ ATP1G1 monoclonal antibody
    Target Antigen GM-Tg-g-MP0455-Ag FXYD2 VLP (virus-like particle)
    ORF Viral Vector pGMLP000938 Human FXYD2 Lentivirus plasmid
    ORF Viral Vector vGMLP000938 Human FXYD2 Lentivirus particle


    Target information

    Target ID GM-MP0455
    Target Name FXYD2
    Gene Group Identifier
    (Target Gene ID in Homo species)
    486
    Gene ID 100629801 (Equus caballus), 101087093 (Felis catus), 11936 (Mus musculus), 281773 (Bos taurus)
    29639 (Rattus norvegicus), 486 (Homo sapiens), 608594 (Canis lupus familiaris)
    Gene Symbols & Synonyms FXYD2,Fxyd2,Atp1g1,ATP1C,GNAKATP,HOMG2,ATP1G1
    Target Alternative Names FXYD2,Sodium/potassium-transporting ATPase subunit gamma,Na(+)/K(+) ATPase subunit gamma,FXYD domain-containing ion transport regulator 2, Sodium pump gamma chain,HOMG2,ATP1G1
    Uniprot Accession P54710,Q04645,Q04646,Q04679
    Additional SwissProt Accessions: Q04646,Q04645,Q04679,P54710
    Uniprot Entry Name
    Protein Sub-location Transmembrane Protein
    Category
    Disease
    Disease from KEGG cGMP-PKG signaling pathway, cAMP signaling pathway, Adrenergic signaling in cardiomyocytes, Insulin secretion, Thyroid hormone synthesis, Thyroid hormone signaling pathway, Aldosterone-regulated sodium reabsorption, Salivary secretion, Pancreatic secretion, Carbohydrate digestion and absorption, Protein digestion and absorption, Bile secretion, Mineral absorption
    Gene Ensembl ENSMUSG00000059412, ENSG00000137731, ENSCAFG00845003379
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.