Human KCNE2/ATFB4/LQT5 ORF/cDNA clone-Lentivirus particle (NM_172201)

Cat. No.: vGMLP000905

Pre-made Human KCNE2/ATFB4/LQT5 Lentiviral expression plasmid for KCNE2 lentivirus packaging, KCNE2 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to KCNE2/ATFB4 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP000905 Human KCNE2 Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP000905
Gene Name KCNE2
Accession Number NM_172201
Gene ID 9992
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 372 bp
Gene Alias ATFB4,LQT5,LQT6,MIRP1
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGTCTACTTTATCCAATTTCACACAGACGCTGGAAGACGTCTTCCGAAGGATTTTTATTACTTATATGGACAATTGGCGCCAGAACACAACAGCTGAGCAAGAGGCCCTCCAAGCCAAAGTTGATGCTGAGAACTTCTACTATGTCATCCTGTACCTCATGGTGATGATTGGAATGTTCTCTTTCATCATCGTGGCCATCCTGGTGAGCACTGTGAAATCCAAGAGACGGGAACACTCCAATGACCCCTACCACCAGTACATTGTAGAGGACTGGCAGGAAAAGTACAAGAGCCAAATCTTGAATCTAGAAGAATCGAAGGCCACCATCCATGAGAACATTGGTGCGGCTGGGTTCAAAATGTCCCCCTGA
ORF Protein Sequence MSTLSNFTQTLEDVFRRIFITYMDNWRQNTTAEQEALQAKVDAENFYYVILYLMVMIGMFSFIIVAILVSTVKSKRREHSNDPYHQYIVEDWQEKYKSQILNLEESKATIHENIGAAGFKMSP

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-MP0656-Ab Anti-KCNE2/ ATFB4/ LQT5 monoclonal antibody
    Target Antigen GM-Tg-g-MP0656-Ag KCNE2 VLP (virus-like particle)
    ORF Viral Vector pGMLP000905 Human KCNE2 Lentivirus plasmid
    ORF Viral Vector vGMLP000905 Human KCNE2 Lentivirus particle


    Target information

    Target ID GM-MP0656
    Target Name KCNE2
    Gene Group Identifier
    (Target Gene ID in Homo species)
    9992
    Gene ID 100062720 (Equus caballus), 101086335 (Felis catus), 171138 (Rattus norvegicus), 246133 (Mus musculus)
    403471 (Canis lupus familiaris), 768025 (Bos taurus), 9992 (Homo sapiens)
    Gene Symbols & Synonyms KCNE2,Kcne2,Mirp1,MiRP1,2200002I16Rik,LQT5,LQT6,ATFB4,MIRP1
    Target Alternative Names 2200002I16Rik,ATFB4,KCNE2,Kcne2,LQT5,LQT6,MIRP1,MiRP1,MinK-related peptide 1 (MiRP1),Minimum potassium ion channel-related peptide 1,Mirp1,Potassium channel subunit beta MiRP1,Potassium voltage-gated channel subfamily E member 2
    Uniprot Accession P63161,Q9D808,Q9Y6J6
    Additional SwissProt Accessions: P63161,Q9D808,Q9Y6J6
    Uniprot Entry Name
    Protein Sub-location Transmembrane Protein
    Category
    Disease
    Disease from KEGG Gastric acid secretion
    Gene Ensembl ENSECAG00000042684, ENSMUSG00000039672, ENSBTAG00000026260, ENSG00000159197
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.