Human PLA2G10/GXPLA2/GXSPLA2 ORF/cDNA clone-Lentivirus particle (NM_003561)

Cat. No.: vGMLP000902

Pre-made Human PLA2G10/GXPLA2/GXSPLA2 Lentiviral expression plasmid for PLA2G10 lentivirus packaging, PLA2G10 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to PLA2G10/GXPLA2 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

pdf MSDS
pdf Datasheet

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP000902 Human PLA2G10 Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP000902
Gene Name PLA2G10
Accession Number NM_003561
Gene ID 8399
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 498 bp
Gene Alias GXPLA2,GXSPLA2,SPLA2,sPLA2-X
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGGGCCGCTACCTGTGTGCCTGCCAATCATGCTGCTCCTGCTACTGCCGTCGCTGCTGCTGCTGCTGCTTCTACCTGGCCCCGGGTCCGGCGAGGCCTCCAGGATATTACGTGTGCACCGGCGTGGGATCCTGGAACTGGCAGGAACTGTGGGTTGTGTTGGTCCCCGAACCCCCATCGCCTATATGAAATATGGTTGCTTTTGTGGCTTGGGAGGCCATGGCCAGCCCCGCGATGCCATTGACTGGTGCTGCCATGGCCACGACTGTTGTTACACTCGAGCTGAGGAGGCCGGCTGCAGCCCCAAGACAGAGCGCTACTCCTGGCAGTGCGTCAATCAGAGCGTCCTGTGCGGACCGGCAGAGAACAAATGCCAAGAACTGTTGTGCAAGTGTGACCAGGAGATTGCTAACTGCTTAGCCCAAACTGAGTACAACTTAAAGTACCTCTTCTACCCCCAGTTCCTATGTGAGCCGGACTCGCCCAAGTGTGACTGA
ORF Protein Sequence MGPLPVCLPIMLLLLLPSLLLLLLLPGPGSGEASRILRVHRRGILELAGTVGCVGPRTPIAYMKYGCFCGLGGHGQPRDAIDWCCHGHDCCYTRAEEAGCSPKTERYSWQCVNQSVLCGPAENKCQELLCKCDQEIANCLAQTEYNLKYLFYPQFLCEPDSPKCD

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-SE0409-Ab Anti-PA2GX/ PLA2G10/ GXPLA2 functional antibody
    Target Antigen GM-Tg-g-SE0409-Ag PLA2G10 protein
    ORF Viral Vector pGMLP000902 Human PLA2G10 Lentivirus plasmid
    ORF Viral Vector vGMLP000902 Human PLA2G10 Lentivirus particle


    Target information

    Target ID GM-SE0409
    Target Name PLA2G10
    Gene Group Identifier
    （Target Gene ID in Homo species)         		8399
    Gene ID 26565 (Mus musculus), 29359 (Rattus norvegicus), 8399 (Homo sapiens)
    Gene Symbols & Synonyms Pla2g10,PLA2G10,PLA2GX,sPLA2-X,GX sPLA2,SPLA2,GXPLA2,GXSPLA2
    Target Alternative Names GX sPLA2,GXPLA2,GXSPLA2,Group 10 secretory phospholipase A2,Group X secretory phospholipase A2 (GX sPLA2,PLA2G10,PLA2GX,Phosphatidylcholine 2-acylhydrolase 10,Pla2g10,SPLA2,sPLA2-X,sPLA2-X)
    Uniprot Accession O15496,Q9QXX3,Q9QZT3
    Additional SwissProt Accessions: Q9QXX3,Q9QZT3,O15496
    Uniprot Entry Name
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category
    Disease
    Disease from KEGG Metabolic pathways, Ras signaling pathway, Vascular smooth muscle contraction, Pancreatic secretion, Fat digestion and absorption, Glycerophospholipid metabolism, Ether lipid metabolism, Arachidonic acid metabolism, Linoleic acid metabolism
    Gene Ensembl ENSMUSG00000022683, ENSG00000069764
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.