Human TNFRSF14/ATAR/CD270 ORF/cDNA clone-Lentivirus particle (NM_001297605)

Cat. No.: vGMLP000899

Pre-made Human TNFRSF14/ATAR/CD270 Lentiviral expression plasmid for TNFRSF14 lentivirus packaging, TNFRSF14 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to HVEM/TNFRSF14/CD270/TNFRSF14/ATAR products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

pdf MSDS
pdf Datasheet

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP000899 Human TNFRSF14 Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP000899
Gene Name TNFRSF14
Accession Number NM_001297605
Gene ID 8764
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 555 bp
Gene Alias ATAR,CD270,HVEA,HVEM,LIGHTR,TR2
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGAGCCTCCTGGAGACTGGGGGCCTCCTCCCTGGAGATCCACCCCCAAAACCGACGTCTTGAGGCTGGTGCTGTATCTCACCTTCCTGGGAGCCCCCTGCTACGCCCCAGCTCTGCCGTCCTGCAAGGAGGACGAGTACCCAGTGGGCTCCGAGTGCTGCCCCAAGTGCAGTCCAGGTTATCGTGTGAAGGAGGCCTGCGGGGAGCTGACGGGCACAGTGTGTGAACCCTGCCCTCCAGGCACCTACATTGCCCACCTCAATGGCCTAAGCAAGTGTCTGCAGTGCCAAATGTGTGACCCAGCCATGGGCCTGCGCGCGAGCCGGAACTGCTCCAGGACAGAGAACGCCGTGTGTGGCTGCAGCCCAGGCCACTTCTGCATCGTCCAGGACGGGGACCACTGCGCCGCGTGCCGCGCTTACGCCACCTCCAGCCCGGGCCAGAGGGTGCAGAAGGGAGGCACCGAGAGTCAGGACACCCTGTGTCAGAACTGCCCCCCGGGGACCTTCTCTCCCAATGGGACCCTGGAGGAATGTCAGCACCAGACCAAGTGA
ORF Protein Sequence MEPPGDWGPPPWRSTPKTDVLRLVLYLTFLGAPCYAPALPSCKEDEYPVGSECCPKCSPGYRVKEACGELTGTVCEPCPPGTYIAHLNGLSKCLQCQMCDPAMGLRASRNCSRTENAVCGCSPGHFCIVQDGDHCAACRAYATSSPGQRVQKGGTESQDTLCQNCPPGTFSPNGTLEECQHQTK

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IO063-Ab Anti-TNR14/ HVEM/ TNFRSF14 monoclonal antibody
    Target Antigen GM-Tg-g-IO063-Ag HVEM/TNFRSF14 VLP (virus-like particle)
    Cytokine cks-Tg-g-GM-IO063 tumor necrosis factor receptor superfamily, member 14 (TNFRSF14) protein & antibody
    ORF Viral Vector pGMLP000899 Human TNFRSF14 Lentivirus plasmid
    ORF Viral Vector vGMLP000899 Human TNFRSF14 Lentivirus particle


    Target information

    Target ID GM-IO063
    Target Name HVEM/TNFRSF14/CD270
    Gene Group Identifier
    （Target Gene ID in Homo species)         		8764
    Gene ID 101089877 (Felis catus), 230979 (Mus musculus), 366518 (Rattus norvegicus), 479580 (Canis lupus familiaris)
    695042 (Macaca mulatta), 8764 (Homo sapiens)
    Gene Symbols & Synonyms TNFRSF14,Tnfrsf14,TR2,Atar,HveA,Hvem,Tnfrs14,HVEM,ATAR,HVEA,CD270,LIGHTR
    Target Alternative Names ATAR,Atar,CD270,HVEA,HVEM,Herpes virus entry mediator A (Herpesvirus entry mediator A,HveA,HveA),Hvem,LIGHTR,TNFRSF14,TR2,Tnfrs14,Tnfrsf14,Tumor necrosis factor receptor superfamily member 14,Tumor necrosis factor receptor-like 2 (TR2)
    Uniprot Accession Q80WM9,Q92956
    Additional SwissProt Accessions: Q80WM9,Q92956
    Uniprot Entry Name
    Protein Sub-location Transmembrane Protein
    Category Therapeutics Target, Immuno-oncology Target, Cytokine Target
    Disease cancer
    Disease from KEGG Cytokine-cytokine receptor interaction, Viral protein interaction with cytokine and cytokine receptor
    Gene Ensembl ENSMUSG00000042333, ENSMMUG00000016329, ENSG00000157873
    Target Classification Checkpoint-Immuno Oncology


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.