Human S100A2/CAN19/S100L ORF/cDNA clone-Lentivirus particle (NM_005978)
Cat. No.: vGMLP000888
Pre-made Human S100A2/CAN19/S100L Lentiviral expression plasmid for S100A2 lentivirus packaging, S100A2 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.
Go to
S100A2/CAN19 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Catalog No. | Product Name | lentivirus Grade | lentivirus quantity |
---|---|---|---|
vGMLP000888 | Human S100A2 Lentivirus particle | Pilot Grade | 1.0E+8TU |
5.0E+8TU | |||
1.0E+9TU | |||
Research Grade | 1.0E+8TU | ||
5.0E+8TU | |||
1.0E+9TU | |||
GMP-like Grade | inquiry | ||
GMP Grade | inquiry |
Product Description
Catalog ID | vGMLP000888 |
Gene Name | S100A2 |
Accession Number | NM_005978 |
Gene ID | 6273 |
Species | Human |
Product Type | Lentivirus particle (overexpression) |
Insert Length | 294 bp |
Gene Alias | CAN19,S100L |
Fluorescent Reporter | ZsGreen |
Mammalian Cell Selection | Puromyocin |
Fusion Tag | 3xflag (C-Terminal) |
Promoter | CMV |
Resistance | Amplicin |
ORF Nucleotide Sequence | ATGATGTGCAGTTCTCTGGAGCAGGCGCTGGCTGTGCTGGTCACTACCTTCCACAAGTACTCCTGCCAAGAGGGCGACAAGTTCAAGCTGAGTAAGGGGGAAATGAAGGAACTTCTGCACAAGGAGCTGCCCAGCTTTGTGGGGGAGAAAGTGGATGAGGAGGGGCTGAAGAAGCTGATGGGCAGCCTGGATGAGAACAGTGACCAGCAGGTGGACTTCCAGGAGTATGCTGTTTTCCTGGCACTCATCACTGTCATGTGCAATGACTTCTTCCAGGGCTGCCCAGACCGACCCTGA |
ORF Protein Sequence | MMCSSLEQALAVLVTTFHKYSCQEGDKFKLSKGEMKELLHKELPSFVGEKVDEEGLKKLMGSLDENSDQQVDFQEYAVFLALITVMCNDFFQGCPDRP |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Target Antibody | GM-Tg-g-IP2724-Ab | Anti-S100A2 monoclonal antibody |
Target Antigen | GM-Tg-g-IP2724-Ag | S100A2 protein |
ORF Viral Vector | pGMLP000888 | Human S100A2 Lentivirus plasmid |
ORF Viral Vector | vGMLP000888 | Human S100A2 Lentivirus particle |
Target information
Target ID | GM-IP2724 |
Target Name | S100A2 |
Gene Group Identifier (Target Gene ID in Homo species) |
6273 |
Gene ID |
100056230 (Equus caballus), 101082878 (Felis catus), 509860 (Bos taurus), 6273 (Homo sapiens) 715264 (Macaca mulatta) |
Gene Symbols & Synonyms | S100A2,CAN19,S100L |
Target Alternative Names | S100A2,Protein S100-A2,CAN19, Protein S-100L, S100 calcium-binding protein A2,CAN19,S100L |
Uniprot Accession |
P10462,P29034
Additional SwissProt Accessions: P10462,P29034 |
Uniprot Entry Name | |
Protein Sub-location | Introcelluar Protein |
Category | |
Disease | cancer |
Disease from KEGG | |
Gene Ensembl | ENSBTAG00000037651, ENSG00000196754, ENSMMUG00000010978 |
Target Classification | Tumor-associated antigen (TAA) |
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.