Human VAMP4/VAMP-4/VAMP24 ORF/cDNA clone-Lentivirus particle (NM_003762)

Cat. No.: vGMLP000853

Pre-made Human VAMP4/VAMP-4/VAMP24 Lentiviral expression plasmid for VAMP4 lentivirus packaging, VAMP4 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to VAMP4/VAMP-4 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

pdf MSDS
pdf Datasheet

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP000853 Human VAMP4 Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP000853
Gene Name VAMP4
Accession Number NM_003762
Gene ID 8674
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 426 bp
Gene Alias VAMP-4,VAMP24
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGCCTCCCAAGTTTAAGCGCCACCTCAATGATGATGATGTCACAGGTTCTGTGAAAAGTGAAAGGAGAAATCTTTTGGAAGATGATTCAGATGAAGAAGAGGACTTTTTTCTAAGGGGACCATCTGGACCAAGATTTGGACCTAGAAATGATAAAATTAAGCATGTTCAGAATCAAGTGGATGAAGTTATTGATGTCATGCAAGAAAATATTACAAAGGTAATTGAGAGAGGGGAGAGACTAGATGAACTACAGGACAAATCAGAAAGCTTATCGGATAATGCAACAGCTTTTAGCAACAGATCCAAACAACTTCGAAGGCAAATGTGGTGGCGTGGATGCAAAATAAAAGCCATCATGGCTTTGGTTGCTGCTATCCTTTTGCTAGTGATTATCATTCTTATAGTCATGAAATACCGTACTTGA
ORF Protein Sequence MPPKFKRHLNDDDVTGSVKSERRNLLEDDSDEEEDFFLRGPSGPRFGPRNDKIKHVQNQVDEVIDVMQENITKVIERGERLDELQDKSESLSDNATAFSNRSKQLRRQMWWRGCKIKAIMALVAAILLLVIIILIVMKYRT

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-MP1912-Ab Anti-VAMP4/ VAMP-4/ VAMP24 monoclonal antibody
    Target Antigen GM-Tg-g-MP1912-Ag VAMP4 VLP (virus-like particle)
    ORF Viral Vector pGMLP000853 Human VAMP4 Lentivirus plasmid
    ORF Viral Vector vGMLP000853 Human VAMP4 Lentivirus particle


    Target information

    Target ID GM-MP1912
    Target Name VAMP4
    Gene Group Identifier
    （Target Gene ID in Homo species)         		8674
    Gene ID 100052201 (Equus caballus), 101087894 (Felis catus), 106559029 (Canis lupus familiaris), 364033 (Rattus norvegicus)
    53330 (Mus musculus), 616923 (Bos taurus), 704733 (Macaca mulatta), 8674 (Homo sapiens)
    Gene Symbols & Synonyms VAMP4,Vamp4,Vamp-4,D1Ertd147e,VAMP-4,VAMP24
    Target Alternative Names VAMP4,Vesicle-associated membrane protein 4,VAMP-4,VAMP-4,VAMP24
    Uniprot Accession O70480,O75379,Q32L97
    Additional SwissProt Accessions: O70480,Q32L97,O75379
    Uniprot Entry Name
    Protein Sub-location Transmembrane Protein
    Category
    Disease Prostate Cancer
    Disease from KEGG SNARE interactions in vesicular transport
    Gene Ensembl ENSECAG00000013165, ENSCAFG00845000980, ENSMUSG00000026696, ENSBTAG00000020591, ENSMMUG00000023203, ENSG00000117533
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.