Human VAMP2/SYB2/VAMP-2 ORF/cDNA clone-Lentivirus particle (NM_014232)

Cat. No.: vGMLP000806

Pre-made Human VAMP2/SYB2/VAMP-2 Lentiviral expression plasmid for VAMP2 lentivirus packaging, VAMP2 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to VAMP2/SYB2 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP000806 Human VAMP2 Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP000806
Gene Name VAMP2
Accession Number NM_014232
Gene ID 6844
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 351 bp
Gene Alias SYB2,VAMP-2
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGTCTGCTACCGCTGCCACGGCCCCCCCTGCTGCCCCGGCTGGGGAGGGTGGTCCCCCTGCACCCCCTCCAAACCTCACCAGTAACAGGAGACTGCAGCAGACCCAGGCCCAGGTGGATGAGGTGGTGGACATCATGAGGGTGAACGTGGACAAGGTCCTGGAGCGAGACCAGAAGCTGTCGGAGCTGGACGACCGTGCAGATGCACTCCAGGCGGGGGCCTCCCAGTTTGAAACAAGCGCAGCCAAGCTCAAGCGCAAATACTGGTGGAAAAACCTCAAGATGATGATCATCTTGGGAGTGATTTGCGCCATCATCCTCATCATCATCATAGTTTACTTCAGCACTTAA
ORF Protein Sequence MSATAATAPPAAPAGEGGPPAPPPNLTSNRRLQQTQAQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNLKMMIILGVICAIILIIIIVYFST

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-TA101-Ab Anti-VAMP2/ SYB2/ VAMP-2 monoclonal antibody
    Target Antigen GM-Tg-g-TA101-Ag VAMP2 VLP (virus-like particle)
    ORF Viral Vector pGMLP000806 Human VAMP2 Lentivirus plasmid
    ORF Viral Vector pGMPC001583 Human VAMP2 Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector vGMLP000806 Human VAMP2 Lentivirus particle


    Target information

    Target ID GM-TA101
    Target Name VAMP2
    Gene Group Identifier
    (Target Gene ID in Homo species)
    6844
    Gene ID 100073047 (Equus caballus), 101101516 (Felis catus), 22318 (Mus musculus), 24803 (Rattus norvegicus)
    282116 (Bos taurus), 479491 (Canis lupus familiaris), 574134 (Macaca mulatta), 6844 (Homo sapiens)
    Gene Symbols & Synonyms VAMP2,Vamp2,Syb2,Syb-2,sybII,Vamp-2,SYB,RATVAMPB,RATVAMPIR,SYB2,VAMP-2,NEDHAHM
    Target Alternative Names NEDHAHM,RATVAMPB,RATVAMPIR,SYB,SYB2,Syb-2,Syb2,Synaptobrevin-2,VAMP-2,VAMP2,Vamp-2,Vamp2,Vesicle-associated membrane protein 2,sybII
    Uniprot Accession P63026,P63027,P63044,P63045,Q9N0Y0
    Additional SwissProt Accessions: P63044,P63045,P63026,Q9N0Y0,P63027
    Uniprot Entry Name
    Protein Sub-location Transmembrane Protein
    Category Therapeutics Target
    Disease
    Disease from KEGG SNARE interactions in vesicular transport, Insulin secretion, Salivary secretion
    Gene Ensembl ENSECAG00000014189, ENSMUSG00000020894, ENSBTAG00000054934, ENSCAFG00845028001, ENSMMUG00000021798, ENSG00000220205
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.