Human CCL25/Ckb15/TECK ORF/cDNA clone-Lentivirus particle (BC130561)

Cat. No.: vGMLP000799

Pre-made Human CCL25/Ckb15/TECK Lentiviral expression plasmid for CCL25 lentivirus packaging, CCL25 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to CCL25/TECK/CCL25/Ckb15 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP000799 Human CCL25 Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP000799
Gene Name CCL25
Accession Number BC130561
Gene ID 6370
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 453 bp
Gene Alias Ckb15,TECK
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGAACCTGTGGCTCCTGGCCTGCCTGGTGGCCGGCTTCCTGGGAGCCTGGGCCCCCGCTGTCCACACCCAAGGTGTCTTTGAGGACTGCTGCCTGGCCTACCACTACCCCATTGGGTGGGCTGTGCTCCGGCGCGCCTGGACTTACCGGATCCAGGAGGTGAGCGGGAGCTGCAATCTGCCTGCTGCGATATTCTACCTCCCCAAGAGACACAGGAAGGTGTGTGGGAACCCCAAAAGCAGGGAGGTGCAGAGAGCCATGAAGCTCCTGGATGCTCGAAATAAGGTTTTTGCAAAGCTCCACCACAACACGCAGACCTTCCAAGCAGGCCCTCATGCTGTAAAGAAGTTGAGTTCTGGAAACTCCAAGTTATCATCATCCAAGTTTAGCAATCCCATCAGCAGCAGCAAGAGGAATGTCTCCCTCCTGATATCAGCTAATTCAGGACTGTGA
ORF Protein Sequence MNLWLLACLVAGFLGAWAPAVHTQGVFEDCCLAYHYPIGWAVLRRAWTYRIQEVSGSCNLPAAIFYLPKRHRKVCGNPKSREVQRAMKLLDARNKVFAKLHHNTQTFQAGPHAVKKLSSGNSKLSSSKFSNPISSSKRNVSLLISANSGL

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-SE0745-Ab Anti-CCL25/ Ckb15/ SCYA25 functional antibody
    Target Antigen GM-Tg-g-SE0745-Ag CCL25 protein
    Cytokine cks-Tg-g-GM-SE0745 chemokine (C-C motif) ligand 25 (CCL25) protein & antibody
    ORF Viral Vector pGMLP000799 Human CCL25 Lentivirus plasmid
    ORF Viral Vector vGMLP000799 Human CCL25 Lentivirus particle


    Target information

    Target ID GM-SE0745
    Target Name CCL25/TECK
    Gene Group Identifier
    (Target Gene ID in Homo species)
    6370
    Gene ID 100066885 (Equus caballus), 102899861 (Felis catus), 20300 (Mus musculus), 360750 (Rattus norvegicus)
    448798 (Canis lupus familiaris), 574219 (Macaca mulatta), 615986 (Bos taurus), 6370 (Homo sapiens)
    Gene Symbols & Synonyms CCL25,Ccl25,TECK,CKb15,Scya25,A130072A22Rik,Ckb15,SCYA25,TECKvar,Ck beta-15
    Target Alternative Names A130072A22Rik,C-C motif chemokine 25,CCL25,CKb15,Ccl25,Chemokine TECK,Ck beta-15,Ckb15,SCYA25,Scya25,Small-inducible cytokine A25,TECK,TECKvar,Thymus-expressed chemokine
    Uniprot Accession O15444,O35903,Q68A93
    Additional SwissProt Accessions: O35903,Q68A93,O15444
    Uniprot Entry Name
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Cytokine Target
    Disease
    Disease from KEGG Cytokine-cytokine receptor interaction, Viral protein interaction with cytokine and cytokine receptor, Chemokine signaling pathway, Intestinal immune network for IgA production
    Gene Ensembl ENSECAG00000020264, ENSMUSG00000023235, ENSCAFG00845028954, ENSMMUG00000010614, ENSBTAG00000005581, ENSG00000131142
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.