Human ELA3A/ELA3 ORF/cDNA clone-Lentivirus particle (BC005918.1)

Cat. No.: vGMLP000753

Pre-made Human ELA3A/ELA3 Lentiviral expression plasmid for ELA3A lentivirus packaging, ELA3A lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to CELA3A/ELA3A/ELA3 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

pdf MSDS
pdf Datasheet

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP000753 Human ELA3A Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP000753
Gene Name ELA3A
Accession Number BC005918.1
Gene ID 10136
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 813 bp
Gene Alias ELA3
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGATGCTCCGGCTGCTCAGTTCCCTCCTCCTTGTGGCCGTTGCCTCAGGCTATGGCCCACCTTCCTCTCACTCTTCCAGCCGCGTTGTCCATGGTGAGGATGCGGTCCCCTACAGCTGGCCCTGGCAGGTTTCCCTGCAGTATGAGAAAAGTGGAAGCTTCTACCACACGTGTGGCGGTAGCCTCACCGCCCCCGATTGGGTTGTGACTGCCGGCCACTGCATCTCGAGGGATCTGACCTACCAGGTGGTGTTGGGTGAGTACAACCTTGCTGTGAAGGAGGGCCCCGAGCAGGTGATCCCCATCAACTCTGAGGAGCTGTTTGTGCATCCACTCTGGAACCGCTCGTGTGTGGCCTGTGGCAATGACATCGCCCTCATCAAGCTCTCACGCAGCGCCCAGCTGGGAGATGCCGTCCAGCTCGCCTCACTCCCTCCCGCTGGTGACATCCTTCCCAACAAGACACCCTGCTACATCACCGGCTGGGGCCGTCTCTATACCAATGGGCCACTCCCAGACGAGCTGCAGCAGGCCCGGCTGCCCGTGGTGGACTATAAGCACTGCTCCAGGTGGAACTGGTGGGGTTCCACCGTGAAGAAAACCATGGTGTGTGCTGGAGGGTACATCCGCTCCGGCTGCAACGGTGACTCTGGAGGACCCCTCAACTGCCCCACAGAGGATGGTGGCTGGCAGGTCCACGGTGTGACCAGCTTTGTTTCTGGCTTTGGCTGCAACTTCATCTGGAAGCCCACGGTGTTCACTCGAGTCTCCGCCTTCATCGACTGGATTGAGGAGACCATAGCAAGCCACTAG
ORF Protein Sequence MMLRLLSSLLLVAVASGYGPPSSHSSSRVVHGEDAVPYSWPWQVSLQYEKSGSFYHTCGGSLTAPDWVVTAGHCISRDLTYQVVLGEYNLAVKEGPEQVIPINSEELFVHPLWNRSCVACGNDIALIKLSRSAQLGDAVQLASLPPAGDILPNKTPCYITGWGRLYTNGPLPDELQQARLPVVDYKHCSRWNWWGSTVKKTMVCAGGYIRSGCNGDSGGPLNCPTEDGGWQVHGVTSFVSGFGCNFIWKPTVFTRVSAFIDWIEETIASH

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-SE0757-Ab Anti-CEL3A/ CELA3A/ ELA3 functional antibody
    Target Antigen GM-Tg-g-SE0757-Ag CELA3A protein
    ORF Viral Vector pGMLP000753 Human ELA3A Lentivirus plasmid
    ORF Viral Vector vGMLP000753 Human ELA3A Lentivirus particle


    Target information

    Target ID GM-SE0757
    Target Name CELA3A
    Gene Group Identifier
    （Target Gene ID in Homo species)         		10136
    Gene ID 10136 (Homo sapiens)
    Gene Symbols & Synonyms CELA3A,ELA3,ELA3A
    Target Alternative Names CELA3A,Chymotrypsin-like elastase family member 3A,ELA3,ELA3A,Elastase IIIA,Elastase-3A,Protease E
    Uniprot Accession P09093
    Additional SwissProt Accessions: P09093
    Uniprot Entry Name
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category
    Disease
    Disease from KEGG Pancreatic secretion, Protein digestion and absorption
    Gene Ensembl ENSG00000142789
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.