Human PGF/D12S1900/PGFL ORF/cDNA clone-Lentivirus particle (NM_002632)
Cat. No.: vGMLP000680
Pre-made Human PGF/D12S1900/PGFL Lentiviral expression plasmid for PGF lentivirus packaging, PGF lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.
Go to
PGF/PIGF/PlGF/PGF/D12S1900 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
| Catalog No. | Product Name | lentivirus Grade | lentivirus quantity |
|---|---|---|---|
| vGMLP000680 | Human PGF Lentivirus particle | Pilot Grade | 1.0E+8TU |
| 5.0E+8TU | |||
| 1.0E+9TU | |||
| Research Grade | 1.0E+8TU | ||
| 5.0E+8TU | |||
| 1.0E+9TU | |||
| GMP-like Grade | inquiry | ||
| GMP Grade | inquiry |
Product Description
| Catalog ID | vGMLP000680 |
| Gene Name | PGF |
| Accession Number | NM_002632 |
| Gene ID | 5228 |
| Species | Human |
| Product Type | Lentivirus particle (overexpression) |
| Insert Length | 513 bp |
| Gene Alias | D12S1900,PGFL,PIGF,PLGF,PlGF-2,SHGC-10760 |
| Fluorescent Reporter | ZsGreen |
| Mammalian Cell Selection | Puromyocin |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | CMV |
| Resistance | Amplicin |
| ORF Nucleotide Sequence | ATGCCGGTCATGAGGCTGTTCCCTTGCTTCCTGCAGCTCCTGGCCGGGCTGGCGCTGCCTGCTGTGCCCCCCCAGCAGTGGGCCTTGTCTGCTGGGAACGGCTCGTCAGAGGTGGAAGTGGTACCCTTCCAGGAAGTGTGGGGCCGCAGCTACTGCCGGGCGCTGGAGAGGCTGGTGGACGTCGTGTCCGAGTACCCCAGCGAGGTGGAGCACATGTTCAGCCCATCCTGTGTCTCCCTGCTGCGCTGCACCGGCTGCTGCGGCGATGAGAATCTGCACTGTGTGCCGGTGGAGACGGCCAATGTCACCATGCAGCTCCTAAAGATCCGTTCTGGGGACCGGCCCTCCTACGTGGAGCTGACGTTCTCTCAGCACGTTCGCTGCGAATGCCGGCCTCTGCGGGAGAAGATGAAGCCGGAAAGGAGGAGACCCAAGGGCAGGGGGAAGAGGAGGAGAGAGAAGCAGAGACCCACAGACTGCCACCTGTGCGGCGATGCTGTTCCCCGGAGGTAA |
| ORF Protein Sequence | MPVMRLFPCFLQLLAGLALPAVPPQQWALSAGNGSSEVEVVPFQEVWGRSYCRALERLVDVVSEYPSEVEHMFSPSCVSLLRCTGCCGDENLHCVPVETANVTMQLLKIRSGDRPSYVELTFSQHVRCECRPLREKMKPERRRPKGRGKRRREKQRPTDCHLCGDAVPRR |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-T70792-Ab | Anti-PLGF/ PlGF/ PGF functional antibody |
| Target Antigen | GM-Tg-g-T70792-Ag | PlGF/PGF protein |
| Cytokine | cks-Tg-g-GM-T70792 | placental growth factor (PGF) protein & antibody |
| ORF Viral Vector | pGMLP000680 | Human PGF Lentivirus plasmid |
| ORF Viral Vector | vGMLP000680 | Human PGF Lentivirus particle |
Target information
| Target ID | GM-T70792 |
| Target Name | PGF/PIGF/PlGF |
|
Gene Group Identifier (Target Gene ID in Homo species) |
5228 |
| Gene ID |
100051349 (Equus caballus), 100855780 (Canis lupus familiaris), 101095904 (Felis catus), 18654 (Mus musculus) 280894 (Bos taurus), 5228 (Homo sapiens), 701219 (Macaca mulatta), 94203 (Rattus norvegicus) |
| Gene Symbols & Synonyms | PGF,Pgf,PIGF,Plgf,PlGF,PGFL,PLGF,PlGF-2,D12S1900,SHGC-10760 |
| Target Alternative Names | D12S1900,PGF,PGFL,PIGF,PLGF,Pgf,PlGF,PlGF-2,Placenta growth factor,Plgf,SHGC-10760 |
| Uniprot Accession |
P49763,P49764,Q63434,Q9XS47
Additional SwissProt Accessions: P49764,Q9XS47,P49763,Q63434 |
| Uniprot Entry Name | |
| Protein Sub-location | Secreted Protein/Potential Cytokines |
| Category | Therapeutics Target, Diagnostics Biomarker, Cytokine Target |
| Disease | Impaired renal function disease, Pre-eclampsia |
| Disease from KEGG | MAPK signaling pathway, Ras signaling pathway, Rap1 signaling pathway, PI3K-Akt signaling pathway, Focal adhesion, Pathways in cancer |
| Gene Ensembl | ENSMUSG00000004791, ENSBTAG00000013688, ENSG00000119630, ENSMMUG00000002909 |
| Target Classification |
About GMVC

GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.


