Human PLLP/PMLP/TM4SF11 ORF/cDNA clone-Lentivirus particle (NM_015993)

Cat. No.: vGMLP000672

Pre-made Human PLLP/PMLP/TM4SF11 Lentiviral expression plasmid for PLLP lentivirus packaging, PLLP lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to Plasmolipin/PLLP/PLLP/PMLP products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP000672 Human PLLP Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP000672
Gene Name PLLP
Accession Number NM_015993
Gene ID 51090
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 549 bp
Gene Alias PMLP,TM4SF11
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCCGAGTTCCCGTCGAAAGTTAGCACGCGGACCAGCAGTCCTGCGCAGGGCGCCGAAGCCTCGGTGTCGGCGCTGCGCCCGGACCTGGGCTTCGTGCGCTCCCGCCTCGGGGCGCTCATGCTGCTGCAGCTGGTGCTGGGGCTGCTGGTGTGGGCGCTGATTGCGGACACCCCGTACCACCTGTATCCGGCCTATGGCTGGGTGATGTTCGTCGCTGTCTTCCTCTGGCTGGTGACAATCGTCCTCTTCAACCTCTACCTGTTTCAGCTGCACATGAAGTTGTACATGGTTCCCTGGCCACTGGTGTTAATGATCTTTAACATCAGCGCCACCGTTCTCTACATCACCGCCTTCATCGCCTGCTCTGCGGCAGTTGACCTGACATCCCTGAGGGGCACCCGGCCTTATAACCAGCGCGCGGCTGCCTCGTTCTTTGCGTGTTTGGTGATGATCGCCTATGGAGTGAGTGCCTTCTTCAGCTACCAGGCCTGGCGAGGAGTAGGCAGCAATGCGGCCACCAGTCAGATGGCTGGCGGCTATGCCTAA
ORF Protein Sequence MAEFPSKVSTRTSSPAQGAEASVSALRPDLGFVRSRLGALMLLQLVLGLLVWALIADTPYHLYPAYGWVMFVAVFLWLVTIVLFNLYLFQLHMKLYMVPWPLVLMIFNISATVLYITAFIACSAAVDLTSLRGTRPYNQRAAASFFACLVMIAYGVSAFFSYQAWRGVGSNAATSQMAGGYA

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP1415-Ab Anti-PLLP monoclonal antibody
    Target Antigen GM-Tg-g-IP1415-Ag PLLP protein
    ORF Viral Vector pGMLP000672 Human PLLP Lentivirus plasmid
    ORF Viral Vector vGMLP000672 Human PLLP Lentivirus particle


    Target information

    Target ID GM-IP1415
    Target Name Plasmolipin/PLLP
    Gene Group Identifier
    (Target Gene ID in Homo species)
    51090
    Gene ID 100062302 (Equus caballus), 100685289 (Canis lupus familiaris), 101084409 (Felis catus), 51090 (Homo sapiens)
    613446 (Bos taurus), 64364 (Rattus norvegicus), 67801 (Mus musculus), 704120 (Macaca mulatta)
    Gene Symbols & Synonyms PLLP,Pllp,PMLP,TM4SF11,Tm4sf11,Plapi,0610010I06Rik
    Target Alternative Names 0610010I06Rik,PLLP,PMLP,Plapi,Plasma membrane proteolipid,Plasmolipin,Pllp,TM4SF11,Tm4sf11
    Uniprot Accession A6H7B0,P47987,Q9DCU2,Q9Y342
    Additional SwissProt Accessions: Q9Y342,A6H7B0,P47987,Q9DCU2
    Uniprot Entry Name
    Protein Sub-location Introcelluar Protein
    Category
    Disease
    Disease from KEGG
    Gene Ensembl ENSECAG00000018044, ENSCAFG00845003512, ENSG00000102934, ENSBTAG00000011700, ENSMUSG00000031775
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.