Human FASLG/ALPS1B/APT1LG1 ORF/cDNA clone-Lentivirus particle (NM_000639)
Cat. No.: vGMLP000545
Pre-made Human FASLG/ALPS1B/APT1LG1 Lentiviral expression plasmid for FASLG lentivirus packaging, FASLG lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.
Go to
FASLG/CD178/FASLG/ALPS1B products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
| Catalog No. | Product Name | lentivirus Grade | lentivirus quantity |
|---|---|---|---|
| vGMLP000545 | Human FASLG Lentivirus particle | Pilot Grade | 1.0E+8TU |
| 5.0E+8TU | |||
| 1.0E+9TU | |||
| Research Grade | 1.0E+8TU | ||
| 5.0E+8TU | |||
| 1.0E+9TU | |||
| GMP-like Grade | inquiry | ||
| GMP Grade | inquiry |
Product Description
| Catalog ID | vGMLP000545 |
| Gene Name | FASLG |
| Accession Number | NM_000639 |
| Gene ID | 356 |
| Species | Human |
| Product Type | Lentivirus particle (overexpression) |
| Insert Length | 846 bp |
| Gene Alias | ALPS1B,APT1LG1,APTL,CD178,CD95-L,CD95L,FASL,TNFSF6,TNLG1A |
| Fluorescent Reporter | ZsGreen |
| Mammalian Cell Selection | Puromyocin |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | CMV |
| Resistance | Amplicin |
| ORF Nucleotide Sequence | ATGCAGCAGCCCTTCAATTACCCATATCCCCAGATCTACTGGGTGGACAGCAGTGCCAGCTCTCCCTGGGCCCCTCCAGGCACAGTTCTTCCCTGTCCAACCTCTGTGCCCAGAAGGCCTGGTCAAAGGAGGCCACCACCACCACCGCCACCGCCACCACTACCACCTCCGCCGCCGCCGCCACCACTGCCTCCACTACCGCTGCCACCCCTGAAGAAGAGAGGGAACCACAGCACAGGCCTGTGTCTCCTTGTGATGTTTTTCATGGTTCTGGTTGCCTTGGTAGGATTGGGCCTGGGGATGTTTCAGCTCTTCCACCTACAGAAGGAGCTGGCAGAACTCCGAGAGTCTACCAGCCAGATGCACACAGCATCATCTTTGGAGAAGCAAATAGGCCACCCCAGTCCACCCCCTGAAAAAAAGGAGCTGAGGAAAGTGGCCCATTTAACAGGCAAGTCCAACTCAAGGTCCATGCCTCTGGAATGGGAAGACACCTATGGAATTGTCCTGCTTTCTGGAGTGAAGTATAAGAAGGGTGGCCTTGTGATCAATGAAACTGGGCTGTACTTTGTATATTCCAAAGTATACTTCCGGGGTCAATCTTGCAACAACCTGCCCCTGAGCCACAAGGTCTACATGAGGAACTCTAAGTATCCCCAGGATCTGGTGATGATGGAGGGGAAGATGATGAGCTACTGCACTACTGGGCAGATGTGGGCCCGCAGCAGCTACCTGGGGGCAGTGTTCAATCTTACCAGTGCTGATCATTTATATGTCAACGTATCTGAGCTCTCTCTGGTCAATTTTGAGGAATCTCAGACGTTTTTCGGCTTATATAAGCTCTAA |
| ORF Protein Sequence | MQQPFNYPYPQIYWVDSSASSPWAPPGTVLPCPTSVPRRPGQRRPPPPPPPPPLPPPPPPPPLPPLPLPPLKKRGNHSTGLCLLVMFFMVLVALVGLGLGMFQLFHLQKELAELRESTSQMHTASSLEKQIGHPSPPPEKKELRKVAHLTGKSNSRSMPLEWEDTYGIVLLSGVKYKKGGLVINETGLYFVYSKVYFRGQSCNNLPLSHKVYMRNSKYPQDLVMMEGKMMSYCTTGQMWARSSYLGAVFNLTSADHLYVNVSELSLVNFEESQTFFGLYKL |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Biosimilar | GMP-Bios-INN-741 | Pre-Made Asunercept Biosimilar, Fusion Protein targeting FASLG/CD178 fused with human IGHG1 Fc (Fragment constant): Recombinant therapeutic protein targeting ALPS1B/APT1LG1/APTL/CD95-L/CD95L/FASL/TNFSF6/TNLG1A |
| Target Antibody | GM-Tg-g-T64245-Ab | Anti-TNFL6/ CD178/ FASLG monoclonal antibody |
| Target Antigen | GM-Tg-g-T64245-Ag | CD178/FASLG VLP (virus-like particle) |
| Cytokine | cks-Tg-g-GM-T64245 | Fas ligand (TNF superfamily, member 6) (FASL) protein & antibody |
| ORF Viral Vector | pGMLP000545 | Human FASLG Lentivirus plasmid |
| ORF Viral Vector | pGMAP000429 | Human FASLG Adenovirus plasmid |
| ORF Viral Vector | vGMLP000545 | Human FASLG Lentivirus particle |
| ORF Viral Vector | vGMAP000429 | Human FASLG Adenovirus particle |
Target information
| Target ID | GM-T64245 |
| Target Name | FASLG/CD178 |
|
Gene Group Identifier (Target Gene ID in Homo species) |
356 |
| Gene ID |
100052326 (Equus caballus), 14103 (Mus musculus), 25385 (Rattus norvegicus), 356 (Homo sapiens) 407111 (Bos taurus), 442968 (Canis lupus familiaris), 493945 (Felis catus), 574159 (Macaca mulatta) |
| Gene Symbols & Synonyms | FASLG,Fasl,Faslg,fasL,TNLG1A,gld,CD178,CD95L,Fas-L,CD95-L,Tnfsf6,Tnlg1a,APT1LG1,Apt1Lg1,APTL,FASL,ALPS1B,TNFSF6 |
| Target Alternative Names | ALPS1B,APT1LG1,APTL,Apoptosis antigen ligand (APTL),Apt1Lg1,CD178,CD95 ligand (CD95-L),CD95-L,CD95L,FASL,FASLG,Fas antigen ligand (Fas ligand,Fas-L,FasL),Fasl,Faslg,TNFSF6,TNLG1A,Tnfsf6,Tnlg1a,Tumor necrosis factor ligand superfamily member 6,fasL,gld |
| Uniprot Accession |
P36940,P41047,P48023,P63307,Q861W5
Additional SwissProt Accessions: P41047,P36940,P48023,Q861W5,P63307 |
| Uniprot Entry Name | |
| Protein Sub-location | Transmembrane Protein |
| Category | Therapeutics Target, INN Index, Cytokine Target |
| Disease | cancer, Malignant neoplasm of bladder |
| Disease from KEGG | MAPK signaling pathway, Ras signaling pathway, Cytokine-cytokine receptor interaction, FoxO signaling pathway, PI3K-Akt signaling pathway, Apoptosis, Natural killer cell mediated cytotoxicity, Neurotrophin signaling pathway, Alcoholic liver disease, Type I diabetes mellitus, Pathogenic Escherichia coli infection, Chagas disease, African trypanosomiasis, Hepatitis C, Hepatitis B, Measles, Human cytomegalovirus infection, Influenza A, Human papillomavirus infection, Pathways in cancer, Proteoglycans in cancer, Autoimmune thyroid disease, Allograft rejection, Graft-versus-host disease, Lipid and atherosclerosis |
| Gene Ensembl | ENSECAG00000016549, ENSMUSG00000000817, ENSG00000117560, ENSBTAG00000032808, ENSCAFG00845012259, ENSMMUG00000065134 |
| Target Classification |
About GMVC

GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.


