Human FASLG/ALPS1B/APT1LG1 ORF/cDNA clone-Lentivirus particle (NM_000639)

Cat. No.: vGMLP000545

Pre-made Human FASLG/ALPS1B/APT1LG1 Lentiviral expression plasmid for FASLG lentivirus packaging, FASLG lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to FASLG/CD178/FASLG/ALPS1B products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

pdf MSDS
pdf Datasheet

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP000545 Human FASLG Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP000545
Gene Name FASLG
Accession Number NM_000639
Gene ID 356
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 846 bp
Gene Alias ALPS1B,APT1LG1,APTL,CD178,CD95-L,CD95L,FASL,TNFSF6,TNLG1A
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGCAGCAGCCCTTCAATTACCCATATCCCCAGATCTACTGGGTGGACAGCAGTGCCAGCTCTCCCTGGGCCCCTCCAGGCACAGTTCTTCCCTGTCCAACCTCTGTGCCCAGAAGGCCTGGTCAAAGGAGGCCACCACCACCACCGCCACCGCCACCACTACCACCTCCGCCGCCGCCGCCACCACTGCCTCCACTACCGCTGCCACCCCTGAAGAAGAGAGGGAACCACAGCACAGGCCTGTGTCTCCTTGTGATGTTTTTCATGGTTCTGGTTGCCTTGGTAGGATTGGGCCTGGGGATGTTTCAGCTCTTCCACCTACAGAAGGAGCTGGCAGAACTCCGAGAGTCTACCAGCCAGATGCACACAGCATCATCTTTGGAGAAGCAAATAGGCCACCCCAGTCCACCCCCTGAAAAAAAGGAGCTGAGGAAAGTGGCCCATTTAACAGGCAAGTCCAACTCAAGGTCCATGCCTCTGGAATGGGAAGACACCTATGGAATTGTCCTGCTTTCTGGAGTGAAGTATAAGAAGGGTGGCCTTGTGATCAATGAAACTGGGCTGTACTTTGTATATTCCAAAGTATACTTCCGGGGTCAATCTTGCAACAACCTGCCCCTGAGCCACAAGGTCTACATGAGGAACTCTAAGTATCCCCAGGATCTGGTGATGATGGAGGGGAAGATGATGAGCTACTGCACTACTGGGCAGATGTGGGCCCGCAGCAGCTACCTGGGGGCAGTGTTCAATCTTACCAGTGCTGATCATTTATATGTCAACGTATCTGAGCTCTCTCTGGTCAATTTTGAGGAATCTCAGACGTTTTTCGGCTTATATAAGCTCTAA
ORF Protein Sequence MQQPFNYPYPQIYWVDSSASSPWAPPGTVLPCPTSVPRRPGQRRPPPPPPPPPLPPPPPPPPLPPLPLPPLKKRGNHSTGLCLLVMFFMVLVALVGLGLGMFQLFHLQKELAELRESTSQMHTASSLEKQIGHPSPPPEKKELRKVAHLTGKSNSRSMPLEWEDTYGIVLLSGVKYKKGGLVINETGLYFVYSKVYFRGQSCNNLPLSHKVYMRNSKYPQDLVMMEGKMMSYCTTGQMWARSSYLGAVFNLTSADHLYVNVSELSLVNFEESQTFFGLYKL

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Biosimilar GMP-Bios-INN-741 Pre-Made Asunercept Biosimilar, Fusion Protein targeting FASLG/CD178 fused with human IGHG1 Fc (Fragment constant): Recombinant therapeutic protein targeting ALPS1B/APT1LG1/APTL/CD95-L/CD95L/FASL/TNFSF6/TNLG1A
    Target Antibody GM-Tg-g-T64245-Ab Anti-TNFL6/ CD178/ FASLG monoclonal antibody
    Target Antigen GM-Tg-g-T64245-Ag CD178/FASLG VLP (virus-like particle)
    Cytokine cks-Tg-g-GM-T64245 Fas ligand (TNF superfamily, member 6) (FASL) protein & antibody
    ORF Viral Vector pGMLP000545 Human FASLG Lentivirus plasmid
    ORF Viral Vector pGMAP000429 Human FASLG Adenovirus plasmid
    ORF Viral Vector vGMLP000545 Human FASLG Lentivirus particle
    ORF Viral Vector vGMAP000429 Human FASLG Adenovirus particle


    Target information

    Target ID GM-T64245
    Target Name FASLG/CD178
    Gene Group Identifier
    （Target Gene ID in Homo species)         		356
    Gene ID 100052326 (Equus caballus), 14103 (Mus musculus), 25385 (Rattus norvegicus), 356 (Homo sapiens)
    407111 (Bos taurus), 442968 (Canis lupus familiaris), 493945 (Felis catus), 574159 (Macaca mulatta)
    Gene Symbols & Synonyms FASLG,Fasl,Faslg,fasL,TNLG1A,gld,CD178,CD95L,Fas-L,CD95-L,Tnfsf6,Tnlg1a,APT1LG1,Apt1Lg1,APTL,FASL,ALPS1B,TNFSF6
    Target Alternative Names FASLG, CD178,Tumor necrosis factor ligand superfamily member 6,Apoptosis antigen ligand (APTL), CD95 ligand (CD95-L), Fas antigen ligand (Fas ligand, FasL),APTL,FASL,CD178,CD95L,ALPS1B,CD95-L,TNFSF6,TNLG1A,APT1LG1
    Uniprot Accession P36940,P41047,P48023,P63307,Q861W5
    Additional SwissProt Accessions: P41047,P36940,P48023,Q861W5,P63307
    Uniprot Entry Name
    Protein Sub-location Transmembrane Protein
    Category Therapeutics Target, INN Index, Cytokine Target
    Disease cancer, Malignant neoplasm of bladder
    Disease from KEGG MAPK signaling pathway, Ras signaling pathway, Cytokine-cytokine receptor interaction, FoxO signaling pathway, PI3K-Akt signaling pathway, Apoptosis, Natural killer cell mediated cytotoxicity, Neurotrophin signaling pathway, Alcoholic liver disease, Type I diabetes mellitus, Pathogenic Escherichia coli infection, Chagas disease, African trypanosomiasis, Hepatitis C, Hepatitis B, Measles, Human cytomegalovirus infection, Influenza A, Human papillomavirus infection, Pathways in cancer, Proteoglycans in cancer, Autoimmune thyroid disease, Allograft rejection, Graft-versus-host disease, Lipid and atherosclerosis
    Gene Ensembl ENSECAG00000016549, ENSMUSG00000000817, ENSG00000117560, ENSBTAG00000032808, ENSCAFG00845012259, ENSMMUG00000065134
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.