Human NTS/NMN-125/NN ORF/cDNA clone-Lentivirus particle (NM_006183)

Cat. No.: vGMLP000544

Pre-made Human NTS/NMN-125/NN Lentiviral expression plasmid for NTS lentivirus packaging, NTS lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to NTS/NMN-125 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP000544 Human NTS Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP000544
Gene Name NTS
Accession Number NM_006183
Gene ID 4922
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 513 bp
Gene Alias NMN-125,NN,NT,NT/N,NTS1
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGATGGCAGGAATGAAAATCCAGCTTGTATGCATGCTACTCCTGGCTTTCAGCTCCTGGAGTCTGTGCTCAGATTCAGAAGAGGAAATGAAAGCATTAGAAGCAGATTTCTTGACCAATATGCATACATCAAAGATTAGTAAAGCACATGTTCCCTCTTGGAAGATGACTCTGCTAAATGTTTGCAGTCTTGTAAATAATTTGAACAGCCCAGCTGAGGAAACAGGAGAAGTTCATGAAGAGGAGCTTGTTGCAAGAAGGAAACTTCCTACTGCTTTAGATGGCTTTAGCTTGGAAGCAATGTTGACAATATACCAGCTCCACAAAATCTGTCACAGCAGGGCTTTTCAACACTGGGAGTTAATCCAGGAAGATATTCTTGATACTGGAAATGACAAAAATGGAAAGGAAGAAGTCATAAAGAGAAAAATTCCTTATATTCTGAAACGGCAGCTGTATGAGAATAAACCCAGAAGACCCTACATACTCAAAAGAGATTCTTACTATTACTGA
ORF Protein Sequence MMAGMKIQLVCMLLLAFSSWSLCSDSEEEMKALEADFLTNMHTSKISKAHVPSWKMTLLNVCSLVNNLNSPAEETGEVHEEELVARRKLPTALDGFSLEAMLTIYQLHKICHSRAFQHWELIQEDILDTGNDKNGKEEVIKRKIPYILKRQLYENKPRRPYILKRDSYYY

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-SE1140-Ab Anti-NEUT/ NTS/ NMN-125 functional antibody
    Target Antigen GM-Tg-g-SE1140-Ag NTS protein
    ORF Viral Vector pGMLP000544 Human NTS Lentivirus plasmid
    ORF Viral Vector pGMAP000426 Human NTS Adenovirus plasmid
    ORF Viral Vector vGMLP000544 Human NTS Lentivirus particle
    ORF Viral Vector vGMAP000426 Human NTS Adenovirus particle


    Target information

    Target ID GM-SE1140
    Target Name NTS
    Gene Group Identifier
    (Target Gene ID in Homo species)
    4922
    Gene ID 100062225 (Equus caballus), 101095835 (Felis catus), 280881 (Bos taurus), 299757 (Rattus norvegicus)
    4922 (Homo sapiens), 611687 (Canis lupus familiaris), 67405 (Mus musculus), 700189 (Macaca mulatta)
    Gene Symbols & Synonyms NTS,Nts,NN,NT,NT/N,NTS1,NMN-125,5033428E16Rik
    Target Alternative Names NTS,Neurotensin/neuromedin N,NN,NT,NT/N,NTS1,NMN-125
    Uniprot Accession P01156,P10673,P20068,P30990,Q9D3P9
    Additional SwissProt Accessions: P01156,P20068,P30990,P10673,Q9D3P9
    Uniprot Entry Name
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category
    Disease
    Disease from KEGG Neuroactive ligand-receptor interaction
    Gene Ensembl ENSECAG00000010879, ENSBTAG00000005305, ENSG00000133636, ENSCAFG00845012392, ENSMUSG00000019890, ENSMMUG00000023155
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.