Human APOC3/APOCIII ORF/cDNA clone-Lentivirus particle (NM_000040)

Cat. No.: vGMLP000502

Pre-made Human APOC3/APOCIII Lentiviral expression plasmid for APOC3 lentivirus packaging, APOC3 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to APOC3/ApoCIII/APOC3/APOCIII products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP000502 Human APOC3 Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP000502
Gene Name APOC3
Accession Number NM_000040
Gene ID 345
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 300 bp
Gene Alias APOCIII
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGCAGCCCCGGGTACTCCTTGTTGTTGCCCTCCTGGCGCTCCTGGCCTCTGCCCGAGCTTCAGAGGCCGAGGATGCCTCCCTTCTCAGCTTCATGCAGGGTTACATGAAGCACGCCACCAAGACCGCCAAGGATGCACTGAGCAGCGTGCAGGAGTCCCAGGTGGCCCAGCAGGCCAGGGGCTGGGTGACCGATGGCTTCAGTTCCCTGAAAGACTACTGGAGCACCGTTAAGGACAAGTTCTCTGAGTTCTGGGATTTGGACCCTGAGGTCAGACCAACTTCAGCCGTGGCTGCCTGA
ORF Protein Sequence MQPRVLLVVALLALLASARASEAEDASLLSFMQGYMKHATKTAKDALSSVQESQVAQQARGWVTDGFSSLKDYWSTVKDKFSEFWDLDPEVRPTSAVAA

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T31518-Ab Anti-APOC3/ ApoCIII/ APOCIII functional antibody
    Target Antigen GM-Tg-g-T31518-Ag ApoCIII/APOC3 protein
    ORF Viral Vector pGMLP000502 Human APOC3 Lentivirus plasmid
    ORF Viral Vector pGMAP000448 Human APOC3 Adenovirus plasmid
    ORF Viral Vector vGMLP000502 Human APOC3 Lentivirus particle
    ORF Viral Vector vGMAP000448 Human APOC3 Adenovirus particle


    Target information

    Target ID GM-T31518
    Target Name APOC3/ApoCIII
    Gene Group Identifier
    (Target Gene ID in Homo species)
    345
    Gene ID 101080822 (Felis catus), 111774219 (Equus caballus), 11814 (Mus musculus), 24207 (Rattus norvegicus)
    345 (Homo sapiens), 442970 (Canis lupus familiaris), 696726 (Macaca mulatta)
    Gene Symbols & Synonyms APOC3,Apoc3,Apo-CIII,ApoC-III,apo-CIII,apoC-III,Apo-C3,ApoC-3,APOCIII
    Target Alternative Names APOC3,APOCIII,Apo-C3,Apo-CIII,ApoC-3,ApoC-III,ApoCIII,Apoc3,Apolipoprotein C-III,Apolipoprotein C3,apo-CIII,apoC-III
    Uniprot Accession P02656,P06759,P0DN28,P12279,P33622
    Additional SwissProt Accessions: P0DN28,P33622,P06759,P02656,P12279
    Uniprot Entry Name
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Therapeutics Target
    Disease leukemia patients, Dent disease
    Disease from KEGG PPAR signaling pathway, Cholesterol metabolism
    Gene Ensembl ENSECAG00000039785, ENSMUSG00000032081, ENSG00000110245, ENSCAFG00845004284
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.