Human CD247/CD3-ZETA/CD3H ORF/cDNA clone-Lentivirus particle (NM_198053)
Cat. No.: vGMLP000498
Pre-made Human CD247/CD3-ZETA/CD3H Lentiviral expression plasmid for CD247 lentivirus packaging, CD247 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.
Go to
CD247/CD3-ZETA products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Catalog No. | Product Name | lentivirus Grade | lentivirus quantity |
---|---|---|---|
vGMLP000498 | Human CD247 Lentivirus particle | Pilot Grade | 1.0E+8TU |
5.0E+8TU | |||
1.0E+9TU | |||
Research Grade | 1.0E+8TU | ||
5.0E+8TU | |||
1.0E+9TU | |||
GMP-like Grade | inquiry | ||
GMP Grade | inquiry |
Product Description
Catalog ID | vGMLP000498 |
Gene Name | CD247 |
Accession Number | NM_198053 |
Gene ID | 919 |
Species | Human |
Product Type | Lentivirus particle (overexpression) |
Insert Length | 495 bp |
Gene Alias | CD3-ZETA,CD3H,CD3Q,CD3Z,IMD25,T3Z,TCRZ |
Fluorescent Reporter | ZsGreen |
Mammalian Cell Selection | Puromyocin |
Fusion Tag | 3xflag (C-Terminal) |
Promoter | CMV |
Resistance | Amplicin |
ORF Nucleotide Sequence | ATGAAGTGGAAGGCGCTTTTCACCGCGGCCATCCTGCAGGCACAGTTGCCGATTACAGAGGCACAGAGCTTTGGCCTGCTGGATCCCAAACTCTGCTACCTGCTGGATGGAATCCTCTTCATCTATGGTGTCATTCTCACTGCCTTGTTCCTGAGAGTGAAGTTCAGCAGGAGCGCAGACGCCCCCGCGTACCAGCAGGGCCAGAACCAGCTCTATAACGAGCTCAATCTAGGACGAAGAGAGGAGTACGATGTTTTGGACAAGAGACGTGGCCGGGACCCTGAGATGGGGGGAAAGCCGCAGAGAAGGAAGAACCCTCAGGAAGGCCTGTACAATGAACTGCAGAAAGATAAGATGGCGGAGGCCTACAGTGAGATTGGGATGAAAGGCGAGCGCCGGAGGGGCAAGGGGCACGATGGCCTTTACCAGGGTCTCAGTACAGCCACCAAGGACACCTACGACGCCCTTCACATGCAGGCCCTGCCCCCTCGCTAA |
ORF Protein Sequence | MKWKALFTAAILQAQLPITEAQSFGLLDPKLCYLLDGILFIYGVILTALFLRVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPQRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPR |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Target Antibody | GM-Tg-g-MP0204-Ab | Anti-CD3Z/ CD247/ CD3-ZETA monoclonal antibody |
Target Antigen | GM-Tg-g-MP0204-Ag | CD247 VLP (virus-like particle) |
ORF Viral Vector | pGMLP000498 | Human CD247 Lentivirus plasmid |
ORF Viral Vector | pGMAP000002 | Human CD247 Adenovirus plasmid |
ORF Viral Vector | vGMLP000498 | Human CD247 Lentivirus particle |
ORF Viral Vector | vGMAP000002 | Human CD247 Adenovirus particle |
Target information
Target ID | GM-MP0204 |
Target Name | CD247 |
Gene Group Identifier (Target Gene ID in Homo species) |
919 |
Gene ID |
100051432 (Equus caballus), 101080604 (Felis catus), 12503 (Mus musculus), 25300 (Rattus norvegicus) 281056 (Bos taurus), 611571 (Canis lupus familiaris), 697814 (Macaca mulatta), 919 (Homo sapiens) |
Gene Symbols & Synonyms | CD247,Cd247,Cd3,T3z,Cd3h,Cd3z,Tcrk,Tcrz,Cd3-eta,Cd3zeta,Cd3-zeta,4930549J05Rik,A430104F18Rik,TCRzeta,CD3Z,T3Z,CD3H,CD3Q,TCRZ,IMD25,CD3ZETA,CD3-ZETA |
Target Alternative Names | CD247,T-cell surface glycoprotein CD3 zeta chain,T-cell receptor T3 zeta chain,T3Z,CD3H,CD3Q,CD3Z,TCRZ,IMD25,CD3ZETA,CD3-ZETA |
Uniprot Accession |
P20963,P24161
Additional SwissProt Accessions: P24161,P20963 |
Uniprot Entry Name | |
Protein Sub-location | Transmembrane Protein |
Category | |
Disease | |
Disease from KEGG | Natural killer cell mediated cytotoxicity, Th1 and Th2 cell differentiation, Th17 cell differentiation, T cell receptor signaling pathway, Chagas disease, Epstein-Barr virus infection, PD-L1 expression and PD-1 checkpoint pathway in cancer |
Gene Ensembl | ENSECAG00000020158, ENSMUSG00000005763, ENSBTAG00000012700, ENSCAFG00845003466, ENSG00000198821 |
Target Classification |
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.