Human OSM ORF/cDNA clone-Lentivirus particle (NM_020530)

Cat. No.: vGMLP000497

Pre-made Human OSM/ Lentiviral expression plasmid for OSM lentivirus packaging, OSM lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to oncostatin M/OSM/OSM products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP000497 Human OSM Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP000497
Gene Name OSM
Accession Number NM_020530
Gene ID 5008
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 759 bp
Gene Alias
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGGGGTACTGCTCACACAGAGGACGCTGCTCAGTCTGGTCCTTGCACTCCTGTTTCCAAGCATGGCGAGCATGGCGGCTATAGGCAGCTGCTCGAAAGAGTACCGCGTGCTCCTTGGCCAGCTCCAGAAGCAGACAGATCTCATGCAGGACACCAGCAGACTCCTGGACCCCTATATACGTATCCAAGGCCTGGATGTTCCTAAACTGAGAGAGCACTGCAGGGAGCGCCCCGGGGCCTTCCCCAGTGAGGAGACCCTGAGGGGGCTGGGCAGGCGGGGCTTCCTGCAGACCCTCAATGCCACACTGGGCTGCGTCCTGCACAGACTGGCCGACTTAGAGCAGCGCCTCCCCAAGGCCCAGGATTTGGAGAGGTCTGGGCTGAACATCGAGGACTTGGAGAAGCTGCAGATGGCGAGGCCGAACATCCTCGGGCTCAGGAACAACATCTACTGCATGGCCCAGCTGCTGGACAACTCAGACACGGCTGAGCCCACGAAGGCTGGCCGGGGGGCCTCTCAGCCGCCCACCCCCACCCCTGCCTCGGATGCTTTTCAGCGCAAGCTGGAGGGCTGCAGGTTCCTGCATGGCTACCATCGCTTCATGCACTCAGTGGGGCGGGTCTTCAGCAAGTGGGGGGAGAGCCCGAACCGGAGCCGGAGACACAGCCCCCACCAGGCCCTGAGGAAGGGGGTGCGCAGGACCAGACCCTCCAGGAAAGGCAAGAGACTCATGACCAGGGGACAGCTGCCCCGGTAG
ORF Protein Sequence MGVLLTQRTLLSLVLALLFPSMASMAAIGSCSKEYRVLLGQLQKQTDLMQDTSRLLDPYIRIQGLDVPKLREHCRERPGAFPSEETLRGLGRRGFLQTLNATLGCVLHRLADLEQRLPKAQDLERSGLNIEDLEKLQMARPNILGLRNNIYCMAQLLDNSDTAEPTKAGRGASQPPTPTPASDAFQRKLEGCRFLHGYHRFMHSVGRVFSKWGESPNRSRRHSPHQALRKGVRRTRPSRKGKRLMTRGQLPR

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T19556-Ab Anti-ONCM/ OSM functional antibody
    Target Antigen GM-Tg-g-T19556-Ag OSM protein
    Cytokine cks-Tg-g-GM-T19556 oncostatin M (OSM) protein & antibody
    ORF Viral Vector pGMLP000497 Human OSM Lentivirus plasmid
    ORF Viral Vector pGMAP000088 Human OSM Adenovirus plasmid
    ORF Viral Vector vGMLP000497 Human OSM Lentivirus particle
    ORF Viral Vector vGMAP000088 Human OSM Adenovirus particle


    Target information

    Target ID GM-T19556
    Target Name oncostatin M/OSM
    Gene Group Identifier
    (Target Gene ID in Homo species)
    5008
    Gene ID 100064031 (Equus caballus), 101094379 (Felis catus), 18413 (Mus musculus), 289747 (Rattus norvegicus)
    319086 (Bos taurus), 5008 (Homo sapiens), 611921 (Canis lupus familiaris), 717994 (Macaca mulatta)
    Gene Symbols & Synonyms OSM,Osm,OncoM
    Target Alternative Names OSM,OncoM,Oncostatin-M,Osm,oncostatin M
    Uniprot Accession P13725,P53346,P53347,Q65Z15
    Additional SwissProt Accessions: P53347,Q65Z15,P53346,P13725
    Uniprot Entry Name
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Therapeutics Target, Cytokine Target
    Disease
    Disease from KEGG Cytokine-cytokine receptor interaction, PI3K-Akt signaling pathway, JAK-STAT signaling pathway
    Gene Ensembl ENSECAG00000042076, ENSMUSG00000058755, ENSBTAG00000016163, ENSG00000099985, ENSCAFG00845030908, ENSMMUG00000005545
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.