Human S100A8/60B8AG/CAGA ORF/cDNA clone-Lentivirus particle (NM_002964)
Cat. No.: vGMLP000464
Pre-made Human S100A8/60B8AG/CAGA Lentiviral expression plasmid for S100A8 lentivirus packaging, S100A8 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.
Go to
S100A8/60B8AG products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
| Catalog No. | Product Name | lentivirus Grade | lentivirus quantity |
|---|---|---|---|
| vGMLP000464 | Human S100A8 Lentivirus particle | Pilot Grade | 1.0E+8TU |
| 5.0E+8TU | |||
| 1.0E+9TU | |||
| Research Grade | 1.0E+8TU | ||
| 5.0E+8TU | |||
| 1.0E+9TU | |||
| GMP-like Grade | inquiry | ||
| GMP Grade | inquiry |
Product Description
| Catalog ID | vGMLP000464 |
| Gene Name | S100A8 |
| Accession Number | NM_002964 |
| Gene ID | 6279 |
| Species | Human |
| Product Type | Lentivirus particle (overexpression) |
| Insert Length | 282 bp |
| Gene Alias | 60B8AG,CAGA,CFAG,CGLA,CP-10,L1Ag,MA387,MIF,MRP8,NIF,P8 |
| Fluorescent Reporter | ZsGreen |
| Mammalian Cell Selection | Puromyocin |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | CMV |
| Resistance | Amplicin |
| ORF Nucleotide Sequence | ATGTTGACCGAGCTGGAGAAAGCCTTGAACTCTATCATCGACGTCTACCACAAGTACTCCCTGATAAAGGGGAATTTCCATGCCGTCTACAGGGATGACCTGAAGAAATTGCTAGAGACCGAGTGTCCTCAGTATATCAGGAAAAAGGGTGCAGACGTCTGGTTCAAAGAGTTGGATATCAACACTGATGGTGCAGTTAACTTCCAGGAGTTCCTCATTCTGGTGATAAAGATGGGCGTGGCAGCCCACAAAAAAAGCCATGAAGAAAGCCACAAAGAGTAG |
| ORF Protein Sequence | MLTELEKALNSIIDVYHKYSLIKGNFHAVYRDDLKKLLETECPQYIRKKGADVWFKELDINTDGAVNFQEFLILVIKMGVAAHKKSHEESHKE |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-T27402-Ab | Anti-S10A8/ S100A8/ 60B8AG monoclonal antibody |
| Target Antigen | GM-Tg-g-T27402-Ag | S100A8 VLP (virus-like particle) |
| ORF Viral Vector | pGMLP000464 | Human S100A8 Lentivirus plasmid |
| ORF Viral Vector | pGMLV000491 | Human S100A8 Lentivirus plasmid |
| ORF Viral Vector | pGMLV000751 | Human S100A8 Lentivirus plasmid |
| ORF Viral Vector | pGMAP000312 | Human S100A8 Adenovirus plasmid |
| ORF Viral Vector | vGMLP000464 | Human S100A8 Lentivirus particle |
| ORF Viral Vector | vGMLV000491 | Human S100A8 Lentivirus particle |
| ORF Viral Vector | vGMLV000751 | Human S100A8 Lentivirus particle |
| ORF Viral Vector | vGMAP000312 | Human S100A8 Adenovirus particle |
Target information
| Target ID | GM-T27402 |
| Target Name | S100A8 |
|
Gene Group Identifier (Target Gene ID in Homo species) |
6279 |
| Gene ID |
100061766 (Equus caballus), 101084164 (Felis catus), 116547 (Rattus norvegicus), 20201 (Mus musculus) 490461 (Canis lupus familiaris), 616818 (Bos taurus), 6279 (Homo sapiens), 714740 (Macaca mulatta) |
| Gene Symbols & Synonyms | S100A8,S100a8,Mrp8,p8,B8Ag,CFAg,Caga,MRP8,CP-10,60B8Ag,P8,MIF,NIF,CAGA,CFAG,CGLA,L1Ag,MA387,60B8AG,S100-A8 |
| Target Alternative Names | 60B8AG,60B8Ag,B8Ag,CAGA,CFAG,CFAg,CGLA,CP-10,Caga,Calgranulin-A,Calprotectin L1L subunit,Cystic fibrosis antigen (CFAG),L1Ag,Leukocyte L1 complex light chain,MA387,MIF,MRP8,Migration inhibitory factor-related protein 8 (MRP-8,Mrp8,NIF,P8,Protein S100-A8,S100 calcium-binding protein A8,S100-A8,S100A8,S100a8,Urinary stone protein band A,p8,p8) |
| Uniprot Accession |
P05109,P27005,P28782,P50115
Additional SwissProt Accessions: P50115,P27005,P28782,P05109 |
| Uniprot Entry Name | |
| Protein Sub-location | Transmembrane Protein |
| Category | Therapeutics Target, Diagnostics Biomarker |
| Disease | cancer, Acute appendicitis, Congenital occlusion of ureteropelvic junction, Contact with and (suspected) exposure to environmental tobacco smoke (acute) (chronic), Malignant neoplasm of bladder |
| Disease from KEGG | IL-17 signaling pathway |
| Gene Ensembl | ENSMUSG00000056054, ENSCAFG00845002217, ENSG00000143546, ENSMMUG00000044778 |
| Target Classification |
About GMVC

GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.


