Human IFNG/IFG/IFI ORF/cDNA clone-Lentivirus particle (NM_000619)

Cat. No.: vGMLP000461

Pre-made Human IFNG/IFG/IFI Lentiviral expression plasmid for IFNG lentivirus packaging, IFNG lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to IFN-gamma/IFNG/IFNG/IFG products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP000461 Human IFNG Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP000461
Gene Name IFNG
Accession Number NM_000619
Gene ID 3458
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 501 bp
Gene Alias IFG,IFI
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGAAATATACAAGTTATATCTTGGCTTTTCAGCTCTGCATCGTTTTGGGTTCTCTTGGCTGTTACTGCCAGGACCCATATGTAAAAGAAGCAGAAAACCTTAAGAAATATTTTAATGCAGGTCATTCAGATGTAGCGGATAATGGAACTCTTTTCTTAGGCATTTTGAAGAATTGGAAAGAGGAGAGTGACAGAAAAATAATGCAGAGCCAAATTGTCTCCTTTTACTTCAAACTTTTTAAAAACTTTAAAGATGACCAGAGCATCCAAAAGAGTGTGGAGACCATCAAGGAAGACATGAATGTCAAGTTTTTCAATAGCAACAAAAAGAAACGAGATGACTTCGAAAAGCTGACTAATTATTCGGTAACTGACTTGAATGTCCAACGCAAAGCAATACATGAACTCATCCAAGTGATGGCTGAACTGTCGCCAGCAGCTAAAACAGGGAAGCGAAAAAGGAGTCAGATGCTGTTTCGAGGTCGAAGAGCATCCCAGTAA
ORF Protein Sequence MKYTSYILAFQLCIVLGSLGCYCQDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRGRRASQ

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Biosimilar GMP-Bios-ab-175 Pre-Made Emapalumab biosimilar, Whole mAb, Anti-IFNG Antibody: Anti-IFG/IFI/IMD69 therapeutic antibody
    Biosimilar GMP-Bios-ab-219 Pre-Made Fontolizumab biosimilar, Whole mAb, Anti-IFNG Antibody: Anti-IFG/IFI/IMD69 therapeutic antibody
    Target Antibody GM-Tg-g-T77664-Ab Anti-IFNG/ IFG/ IFI functional antibody
    Target Antigen GM-Tg-g-T77664-Ag IFNG protein
    Cytokine cks-Tg-g-GM-T77664 interferon, gamma (IFNG) protein & antibody
    ORF Viral Vector pGMLP000461 Human IFNG Lentivirus plasmid
    ORF Viral Vector pGMAD000575 Human IFNG Adenovirus plasmid
    ORF Viral Vector pGMAP000297 Human IFNG Adenovirus plasmid
    ORF Viral Vector pGMPC004769 Human IFNG Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector vGMLP000461 Human IFNG Lentivirus particle
    ORF Viral Vector vGMAD000575 Human IFNG Adenovirus particle
    ORF Viral Vector vGMAP000297 Human IFNG Adenovirus particle


    Target information

    Target ID GM-T77664
    Target Name IFN-gamma/IFNG
    Gene Group Identifier
    (Target Gene ID in Homo species)
    3458
    Gene ID 100034181 (Equus caballus), 15978 (Mus musculus), 25712 (Rattus norvegicus), 281237 (Bos taurus)
    3458 (Homo sapiens), 403801 (Canis lupus familiaris), 493965 (Felis catus), 574282 (Macaca mulatta)
    Gene Symbols & Synonyms IFNG,Ifng,IF2F,Ifg,If2f,IFN-g,IFNG2,IFG,IFI,IMD69,IFN-G,IFN-gamma
    Target Alternative Names IF2F,IFG,IFI,IFN-G,IFN-g,IFN-gamma,IFNG,IFNG2,IMD69,If2f,Ifg,Ifng,Immune interferon,Interferon gamma
    Uniprot Accession P01579,P01580,P01581,P07353,P42160,P42161,P46402,P63310
    Additional SwissProt Accessions: P42160,P01580,P01581,P07353,P01579,P42161,P46402,P63310
    Uniprot Entry Name
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Therapeutics Target, Diagnostics Biomarker, Immuno-oncology Target, INN Index, Cytokine Target
    Disease cancer, Breast Cancer
    Disease from KEGG Cytokine-cytokine receptor interaction, HIF-1 signaling pathway, TGF-beta signaling pathway, Osteoclast differentiation, Antigen processing and presentation, JAK-STAT signaling pathway, Natural killer cell mediated cytotoxicity, IL-17 signaling pathway, Th1 and Th2 cell differentiation, Th17 cell differentiation, T cell receptor signaling pathway, Type I diabetes mellitus, Leishmaniasis, Chagas disease, African trypanosomiasis, Malaria, Toxoplasmosis, Amoebiasis, Tuberculosis, Hepatitis C, Influenza A, Pathways in cancer, PD-L1 expression and PD-1 checkpoint pathway in cancer, Inflammatory bowel disease, Rheumatoid arthritis, Allograft rejection, Graft-versus-host disease, Fluid shear stress and atherosclerosis
    Gene Ensembl ENSECAG00000028288, ENSMUSG00000055170, ENSBTAG00000012529, ENSG00000111537, ENSCAFG00845013680, ENSMMUG00000056408
    Target Classification Cytokine Receptor, Checkpoint-Immuno Oncology


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.