Human PRDX4/AOE37-2/AOE372 ORF/cDNA clone-Lentivirus particle (NM_006406)

Cat. No.: vGMLP000443

Pre-made Human PRDX4/AOE37-2/AOE372 Lentiviral expression plasmid for PRDX4 lentivirus packaging, PRDX4 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to PRDX4/AOE37-2 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

pdf MSDS
pdf Datasheet

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP000443 Human PRDX4 Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP000443
Gene Name PRDX4
Accession Number NM_006406
Gene ID 10549
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 816 bp
Gene Alias AOE37-2,AOE372,HEL-S-97n,PRX-4
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGAGGCGCTGCCGCTGCTAGCCGCGACAACTCCGGACCACGGCCGCCACCGAAGGCTGCTTCTGCTGCCGCTACTGCTGTTCCTGCTGCCGGCTGGAGCTGTGCAGGGCTGGGAGACAGAGGAGAGGCCCCGGACTCGCGAAGAGGAGTGCCACTTCTACGCGGGTGGACAAGTGTACCCGGGAGAGGCATCCCGGGTATCGGTCGCCGACCACTCCCTGCACCTAAGCAAAGCGAAGATTTCCAAGCCAGCGCCCTACTGGGAAGGAACAGCTGTGATCGATGGAGAATTTAAGGAGCTGAAGTTAACTGATTATCGTGGGAAATACTTGGTTTTCTTCTTCTACCCACTTGATTTCACATTTGTGTGTCCAACTGAAATTATCGCTTTTGGCGACAGACTTGAAGAATTCAGATCTATAAATACTGAAGTGGTAGCATGCTCTGTTGATTCACAGTTTACCCATTTGGCCTGGATTAATACCCCTCGAAGACAAGGAGGACTTGGGCCAATAAGGATTCCACTTCTTTCAGATTTGACCCATCAGATCTCAAAGGACTATGGTGTATACCTAGAGGACTCAGGCCACACTCTTAGAGGTCTCTTCATTATTGATGACAAAGGAATCCTAAGACAAATTACTCTGAATGATCTTCCTGTGGGTAGATCAGTGGATGAGACACTACGTTTGGTTCAAGCATTCCAGTACACTGACAAACACGGAGAAGTCTGCCCTGCTGGCTGGAAACCTGGTAGTGAAACAATAATCCCAGATCCAGCTGGAAAGCTGAAGTATTTCGATAAACTGAATTGA
ORF Protein Sequence MEALPLLAATTPDHGRHRRLLLLPLLLFLLPAGAVQGWETEERPRTREEECHFYAGGQVYPGEASRVSVADHSLHLSKAKISKPAPYWEGTAVIDGEFKELKLTDYRGKYLVFFFYPLDFTFVCPTEIIAFGDRLEEFRSINTEVVACSVDSQFTHLAWINTPRRQGGLGPIRIPLLSDLTHQISKDYGVYLEDSGHTLRGLFIIDDKGILRQITLNDLPVGRSVDETLRLVQAFQYTDKHGEVCPAGWKPGSETIIPDPAGKLKYFDKLN

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T76888-Ab Anti-PRDX4/ AOE37-2/ AOE372 functional antibody
    Target Antigen GM-Tg-g-T76888-Ag PRDX4 protein
    ORF Viral Vector pGMLP000443 Human PRDX4 Lentivirus plasmid
    ORF Viral Vector vGMLP000443 Human PRDX4 Lentivirus particle


    Target information

    Target ID GM-T76888
    Target Name PRDX4
    Gene Group Identifier
    （Target Gene ID in Homo species)         		10549
    Gene ID 100059985 (Equus caballus), 101093082 (Felis catus), 10549 (Homo sapiens), 119868403 (Canis lupus familiaris)
    281999 (Bos taurus), 53381 (Mus musculus), 697635 (Macaca mulatta), 85274 (Rattus norvegicus)
    Gene Symbols & Synonyms PRDX4,Prdx4,PRX-4,AOE372,AOE37-2,HEL-S-97n,Prx4,TRANK,Prx-iv
    Target Alternative Names PRDX4,Peroxiredoxin-4,Antioxidant enzyme AOE372 (AOE37-2), Peroxiredoxin IV (Prx-IV), Thioredoxin peroxidase AO372, Thioredoxin-dependent peroxide reductase A0372, Thioredoxin-dependent peroxiredoxin 4,PRX-4,AOE372,AOE37-2,HEL-S-97n
    Uniprot Accession O08807,Q13162,Q9BGI2,Q9Z0V5
    Additional SwissProt Accessions: Q13162,Q9BGI2,O08807,Q9Z0V5
    Uniprot Entry Name
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Therapeutics Target
    Disease Breast Cancer
    Disease from KEGG
    Gene Ensembl ENSECAG00000010085, ENSG00000123131, ENSCAFG00845030129, ENSBTAG00000006165, ENSMUSG00000025289, ENSMMUG00000021366
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.