Click here to discover the largest collection of GeneMedi's Promise-ORF™ ORF/cDNA expression clones
- • Up to 20%-50%* off first purchase
- • Bulk quantities available
- • Citation Reward application
TECHNICAL RESOURCE
Supports
- Talk to our Expert:
[email protected]
Protocol Library Download
 |
 |
Human TGFA/TFGA ORF/cDNA clone-Lentivirus particle (NM_001099691)
Cat. No.: vGMLP000405
Pre-made Human TGFA/TFGA Lentiviral expression plasmid for TGFA lentivirus packaging, TGFA lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.
Go to
TGF Alpha/TGFA/TGFA/TFGA products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
MSDS
| Catalog No. | Product Name | lentivirus Grade | lentivirus quantity |
|---|---|---|---|
| vGMLP000405 | Human TGFA Lentivirus particle | Pilot Grade | 1.0E+8TU |
| 5.0E+8TU | |||
| 1.0E+9TU | |||
| Research Grade | 1.0E+8TU | ||
| 5.0E+8TU | |||
| 1.0E+9TU | |||
| GMP-like Grade | inquiry | ||
| GMP Grade | inquiry |
Product Description
| Catalog ID | vGMLP000405 |
| Gene Name | TGFA |
| Accession Number | NM_001099691 |
| Gene ID | 7039 |
| Species | Human |
| Product Type | Lentivirus particle (overexpression) |
| Insert Length | 480 bp |
| Gene Alias | TFGA |
| Fluorescent Reporter | ZsGreen |
| Mammalian Cell Selection | Puromyocin |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | CMV |
| Resistance | Amplicin |
| ORF Nucleotide Sequence | ATGGTCCCCTCGGCTGGACAGCTCGCCCTGTTCGCTCTGGGTATTGTGTTGGCTGCGTGCCAGGCCTTGGAGAACAGCACGTCCCCGCTGAGTGACCCGCCCGTGGCTGCAGCAGTGGTGTCCCATTTTAATGACTGCCCAGATTCCCACACTCAGTTCTGCTTCCATGGAACCTGCAGGTTTTTGGTGCAGGAGGACAAGCCAGCATGTGTCTGCCATTCTGGGTACGTTGGTGCACGCTGTGAGCATGCGGACCTCCTGGCCGTGGTGGCTGCCAGCCAGAAGAAGCAGGCCATCACCGCCTTGGTGGTGGTCTCCATCGTGGCCCTGGCTGTCCTTATCATCACATGTGTGCTGATACACTGCTGCCAGGTCCGAAAACACTGTGAGTGGTGCCGGGCCCTCATCTGCCGGCACGAGAAGCCCAGCGCCCTCCTGAAGGGAAGAACCGCTTGCTGCCACTCAGAAACAGTGGTCTGA |
| ORF Protein Sequence | MVPSAGQLALFALGIVLAACQALENSTSPLSDPPVAAAVVSHFNDCPDSHTQFCFHGTCRFLVQEDKPACVCHSGYVGARCEHADLLAVVAASQKKQAITALVVVSIVALAVLIITCVLIHCCQVRKHCEWCRALICRHEKPSALLKGRTACCHSETVV |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-T00033-Ab | Anti-TGFA/ TFGA monoclonal antibody |
| Target Antigen | GM-Tg-g-T00033-Ag | TGFA VLP (virus-like particle) |
| Cytokine | cks-Tg-g-GM-T00033 | transforming growth factor, alpha (TGFA) protein & antibody |
| ORF Viral Vector | pGMLP000405 | Human TGFA Lentivirus plasmid |
| ORF Viral Vector | pGMAP000120 | Human TGFA Adenovirus plasmid |
| ORF Viral Vector | vGMLP000405 | Human TGFA Lentivirus particle |
| ORF Viral Vector | vGMAP000120 | Human TGFA Adenovirus particle |
Target information
| Target ID | GM-T00033 |
| Target Name | TGF Alpha/TGFA |
|
Gene Group Identifier （Target Gene ID in Homo species) |
7039 |
| Gene ID |
100060423 (Equus caballus), 101094921 (Felis catus), 21802 (Mus musculus), 24827 (Rattus norvegicus) 403431 (Canis lupus familiaris), 540388 (Bos taurus), 613031 (Macaca mulatta), 7039 (Homo sapiens) |
| Gene Symbols & Synonyms | TGFA,Tgfa,wa1,wa-1,TGFAA,RATTGFAA,TGF alpha,TFGA |
| Target Alternative Names | Protransforming growth factor alpha,RATTGFAA,TFGA,TGF Alpha,TGF alpha,TGFA,TGFAA,Tgfa,wa-1,wa1 |
| Uniprot Accession |
P01134,P01135,P48030,P55244
Additional SwissProt Accessions: P48030,P01134,P55244,P01135 |
| Uniprot Entry Name | |
| Protein Sub-location | Transmembrane Protein |
| Category | Therapeutics Target, Cytokine Target |
| Disease | cancer, cancer patients |
| Disease from KEGG | EGFR tyrosine kinase inhibitor resistance, MAPK signaling pathway, ErbB signaling pathway, Ras signaling pathway, PI3K-Akt signaling pathway, Pathways in cancer, Colorectal cancer, Renal cell carcinoma, Pancreatic cancer, Glioma, Prostate cancer, Non-small cell lung cancer, Hepatocellular carcinoma |
| Gene Ensembl | ENSECAG00000011006, ENSMUSG00000029999, ENSCAFG00845027844, ENSBTAG00000000783, ENSMMUG00000010591, ENSG00000163235 |
| Target Classification |
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.