Human GPR55/LPIR1 ORF/cDNA clone-Lentivirus particle (NM_005683)

Cat. No.: vGMLP000400

Pre-made Human GPR55/LPIR1 Lentiviral expression plasmid for GPR55 lentivirus packaging, GPR55 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to GPR55/LPIR1 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP000400 Human GPR55 Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP000400
Gene Name GPR55
Accession Number NM_005683
Gene ID 9290
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 960 bp
Gene Alias LPIR1
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGAGTCAGCAAAACACCAGTGGGGACTGCCTGTTTGACGGTGTCAACGAGCTGATGAAAACCCTACAGTTTGCAGTCCACATCCCCACCTTCGTCCTGGGCCTGCTCCTCAACCTGCTGGCCATCCATGGCTTCAGCACCTTCCTTAAGAACAGGTGGCCCGATTATGCTGCCACCTCCATCTACATGATCAACCTGGCAGTCTTTGACCTGCTGCTGGTGCTCTCCCTCCCATTCAAGATGGTCCTGTCCCAGGTACAGTCCCCCTTCCCGTCCCTGTGCACCCTGGTGGAGTGCCTTTACTTCGTCAGCATGTACGGAAGCGTCTTCACCATCTGCTTCATCAGCATGGACCGGTTCTTGGCCATCCGTTACCCGCTACTGGTGAGCCACCTCCGGTCCCCCAGGAAGATCTTTGGGATCTGCTGCACCATCTGGGTCCTGGTGTGGACCGGAAGCATCCCTATCTACAGTTTCCATGGGAAAGTGGAAAAATACATGTGCTTCCACAACATGTCTGATGATACCTGGAGCGCCAAGGTCTTCTTCCCGCTGGAGGTGTTTGGCTTCCTCCTTCCCATGGGCATCATGGGCTTCTGCTGCTCCAGGAGCATCCACATCCTGCTGGGCCGCCGAGACCACACCCAGGACTGGGTGCAGCAGAAAGCCTGCATCTACAGCATCGCAGCCAGCCTGGCTGTCTTCGTGGTCTCCTTCCTCCCAGTCCACCTGGGGTTCTTCCTGCAGTTCCTGGTGAGAAACAGCTTTATCGTAGAGTGCAGAGCCAAGCAGAGCATCAGCTTCTTCTTGCAATTGTCCATGTGTTTCTCCAACGTCAACTGCTGCCTGGATGTTTTCTGCTACTACTTTGTCATCAAAGAATTCCGCATGAACATCAGGGCCCACCGGCCTTCCAGGGTCCAGCTGGTCCTGCAGGACACCACGATCTCCCGGGGCTAA
ORF Protein Sequence MSQQNTSGDCLFDGVNELMKTLQFAVHIPTFVLGLLLNLLAIHGFSTFLKNRWPDYAATSIYMINLAVFDLLLVLSLPFKMVLSQVQSPFPSLCTLVECLYFVSMYGSVFTICFISMDRFLAIRYPLLVSHLRSPRKIFGICCTIWVLVWTGSIPIYSFHGKVEKYMCFHNMSDDTWSAKVFFPLEVFGFLLPMGIMGFCCSRSIHILLGRRDHTQDWVQQKACIYSIAASLAVFVVSFLPVHLGFFLQFLVRNSFIVECRAKQSISFFLQLSMCFSNVNCCLDVFCYYFVIKEFRMNIRAHRPSRVQLVLQDTTISRG

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP0028-Ab Anti-GPR55 monoclonal antibody
    Target Antigen GM-Tg-g-IP0028-Ag GPR55 protein
    ORF Viral Vector pGMLP000400 Human GPR55 Lentivirus plasmid
    ORF Viral Vector vGMLP000400 Human GPR55 Lentivirus particle


    Target information

    Target ID GM-IP0028
    Target Name GPR55
    Gene Group Identifier
    (Target Gene ID in Homo species)
    9290
    Gene ID 100063969 (Equus caballus), 101094199 (Felis catus), 227326 (Mus musculus), 486157 (Canis lupus familiaris)
    501177 (Rattus norvegicus), 539107 (Bos taurus), 711323 (Macaca mulatta), 9290 (Homo sapiens)
    Gene Symbols & Synonyms GPR55,Gpr55,CTFL,Gm218,Lpir1,LPIR1
    Target Alternative Names CTFL,G-protein coupled receptor 55,GPR55,Gm218,Gpr55,LPIR1,Lpir1
    Uniprot Accession Q3UJF0,Q9Y2T6
    Additional SwissProt Accessions: Q3UJF0,Q9Y2T6
    Uniprot Entry Name
    Protein Sub-location Introcelluar Protein
    Category Therapeutics Target
    Disease
    Disease from KEGG
    Gene Ensembl ENSECAG00000006322, ENSMUSG00000049608, ENSCAFG00845021971, ENSBTAG00000059603, ENSMMUG00000056686, ENSG00000135898
    Target Classification GPCR


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.