Human S100A6/2A9/5B10 ORF/cDNA clone-Lentivirus particle (NM_014624)

Cat. No.: vGMLP000396

Pre-made Human S100A6/2A9/5B10 Lentiviral expression plasmid for S100A6 lentivirus packaging, S100A6 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to S100A6/2A9 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP000396 Human S100A6 Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP000396
Gene Name S100A6
Accession Number NM_014624
Gene ID 6277
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 273 bp
Gene Alias 2A9,5B10,CABP,CACY,PRA,S10A6
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCATGCCCCCTGGATCAGGCCATTGGCCTCCTCGTGGCCATCTTCCACAAGTACTCCGGCAGGGAGGGTGACAAGCACACCCTGAGCAAGAAGGAGCTGAAGGAGCTGATCCAGAAGGAGCTCACCATTGGCTCGAAGCTGCAGGATGCTGAAATTGCAAGGCTGATGGAAGACTTGGACCGGAACAAGGACCAGGAGGTGAACTTCCAGGAGTATGTCACCTTCCTGGGGGCCTTGGCTTTGATCTACAATGAAGCCCTCAAGGGCTGA
ORF Protein Sequence MACPLDQAIGLLVAIFHKYSGREGDKHTLSKKELKELIQKELTIGSKLQDAEIARLMEDLDRNKDQEVNFQEYVTFLGALALIYNEALKG

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T68513-Ab Anti-S10A6/ S100A6/ 2A9 monoclonal antibody
    Target Antigen GM-Tg-g-T68513-Ag S100A6 VLP (virus-like particle)
    ORF Viral Vector pGMLP000396 Human S100A6 Lentivirus plasmid
    ORF Viral Vector pGMLV002374 Human S100A6 Lentivirus plasmid
    ORF Viral Vector pGMPC001633 Human S100A6 Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector vGMLP000396 Human S100A6 Lentivirus particle
    ORF Viral Vector vGMLV002374 Human S100A6 Lentivirus particle


    Target information

    Target ID GM-T68513
    Target Name S100A6
    Gene Group Identifier
    (Target Gene ID in Homo species)
    6277
    Gene ID 100033887 (Equus caballus), 101083651 (Felis catus), 20200 (Mus musculus), 480143 (Canis lupus familiaris)
    6277 (Homo sapiens), 715169 (Macaca mulatta), 85247 (Rattus norvegicus)
    Gene Symbols & Synonyms S100A6,S100a6,CACY,2A9,PRA,5B10,Cacy,CALCYCLIN,CABP,S10A6
    Target Alternative Names S100A6,Protein S100-A6,Calcyclin, Growth factor-inducible protein 2A9, MLN 4, Prolactin receptor-associated protein (PRA), S100 calcium-binding protein A6,2A9,PRA,5B10,CABP,CACY,S10A6
    Uniprot Accession O77691,P05964,P06703,P14069
    Additional SwissProt Accessions: O77691,P14069,P06703,P05964
    Uniprot Entry Name
    Protein Sub-location Transmembrane Protein
    Category Therapeutics Target
    Disease cancer, Breast Cancer, Congenital occlusion of ureteropelvic junction, Gastrointestinal system cancer
    Disease from KEGG
    Gene Ensembl ENSMUSG00000001025, ENSG00000197956, ENSMMUG00000008917
    Target Classification Nuclear Receptors


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.