Human CLDN7/claudin-1/Hs.84359 ORF/cDNA clone-Lentivirus particle (BC001055)

Cat. No.: vGMLP000382

Pre-made Human CLDN7/claudin-1/Hs.84359 Lentiviral expression plasmid for CLDN7 lentivirus packaging, CLDN7 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to Claudin 7/CLDN7/CLDN7/claudin-1 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP000382 Human CLDN7 Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP000382
Gene Name CLDN7
Accession Number BC001055
Gene ID 1366
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 636 bp
Gene Alias claudin-1,Hs.84359
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCCAATTCGGGCCTGCAGTTGCTGGGCTTCTCCATGGCCCTGCTGGGCTGGGTGGGTCTGGTGGCCTGCACCGCCATCCCGCAGTGGCAGATGAGCTCCTATGCGGGTGACAACATCATCACGGCCCAGGCCATGTACAAGGGGCTGTGGATGGACTGCGTCACGCAGAGCACGGGGATGATGAGCTGCAAAATGTACGACTCGGTGCTCGCCCTGTCCGCGGCCTTGCAGGCCACTCGAGCCCTAATGGTGGTCTCCCTGGTGCTGGGCTTCCTGGCCATGTTTGTGGCCACGATGGGCATGAAGTGCACGCGCTGTGGGGGAGACGACAAAGTGAAGAAGGCCCGTATAGCCATGGGTGGAGGCATAATTTTCATCGTGGCAGGTCTTGCCACCTTGGTAGCTTGCTCCTGGTATGGCCATCAGATTGTCACAGACTTTTATAACCCTTTGATCCCTACCAACATTAAGTATGAGTTTGGCCCTGCCATCTTTATTGGCTGGGCAGGGTCTGCCCTAGTCATCCTGGGAGGTGCACTGCTCTCCTGTTCCTGTCCTGGGAATGAGAGCAAGGCTGGGTACCGTGCACCCCGCTCTTACCCTAAGTCCAACTCTTCCAAGGAGTATGTGTGA
ORF Protein Sequence MANSGLQLLGFSMALLGWVGLVACTAIPQWQMSSYAGDNIITAQAMYKGLWMDCVTQSTGMMSCKMYDSVLALSAALQATRALMVVSLVLGFLAMFVATMGMKCTRCGGDDKVKKARIAMGGGIIFIVAGLATLVACSWYGHQIVTDFYNPLIPTNIKYEFGPAIFIGWAGSALVILGGALLSCSCPGNESKAGYRAPRSYPKSNSSKEYV

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-MP0286-Ab Anti-CLD7/ CLDN7/ CEPTRL2 monoclonal antibody
    Target Antigen GM-Tg-g-MP0286-Ag CLDN7 VLP (virus-like particle)
    ORF Viral Vector pGMLP000382 Human CLDN7 Lentivirus plasmid
    ORF Viral Vector pGMAP000040 Human CLDN7 Adenovirus plasmid
    ORF Viral Vector pGMAP000104 Human CLDN7 Adenovirus plasmid
    ORF Viral Vector pGMPC000063 Human CLDN7 Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector vGMLP000382 Human CLDN7 Lentivirus particle
    ORF Viral Vector vGMAP000040 Human CLDN7 Adenovirus particle
    ORF Viral Vector vGMAP000104 Human CLDN7 Adenovirus particle


    Target information

    Target ID GM-MP0286
    Target Name Claudin 7/CLDN7
    Gene Group Identifier
    (Target Gene ID in Homo species)
    1366
    Gene ID 100072960 (Equus caballus), 101096019 (Felis catus), 1366 (Homo sapiens), 489466 (Canis lupus familiaris)
    512975 (Bos taurus), 53624 (Mus musculus), 65132 (Rattus norvegicus), 714647 (Macaca mulatta)
    Gene Symbols & Synonyms CLDN7,Cldn7,CLDN-7,CEPTRL2,CPETRL2,Hs.84359,claudin-1,cld-7
    Target Alternative Names Claudin 7, CLDN7,Claudin-7,CLDN-7,CLDN-7,CEPTRL2,CPETRL2,Hs.84359,claudin-1
    Uniprot Accession O95471,Q3B7N4,Q9Z1L1,Q9Z261
    Additional SwissProt Accessions: O95471,Q3B7N4,Q9Z261,Q9Z1L1
    Uniprot Entry Name
    Protein Sub-location Transmembrane Protein
    Category
    Disease cancer
    Disease from KEGG Cell adhesion molecules, Tight junction, Leukocyte transendothelial migration, Pathogenic Escherichia coli infection, Hepatitis C
    Gene Ensembl ENSECAG00000007289, ENSG00000181885, ENSCAFG00845020640, ENSBTAG00000019448, ENSMUSG00000018569, ENSMMUG00000010551
    Target Classification Tumor-associated antigen (TAA)


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.