Human ATP6V0C/ATP6C/ATP6L ORF/cDNA clone-Lentivirus particle (NM_001694)
Cat. No.: vGMLP000338
Pre-made Human ATP6V0C/ATP6C/ATP6L Lentiviral expression plasmid for ATP6V0C lentivirus packaging, ATP6V0C lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.
Go to
ATP6V0C/ATP6C products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Catalog No. | Product Name | lentivirus Grade | lentivirus quantity |
---|---|---|---|
vGMLP000338 | Human ATP6V0C Lentivirus particle | Pilot Grade | 1.0E+8TU |
5.0E+8TU | |||
1.0E+9TU | |||
Research Grade | 1.0E+8TU | ||
5.0E+8TU | |||
1.0E+9TU | |||
GMP-like Grade | inquiry | ||
GMP Grade | inquiry |
Product Description
Catalog ID | vGMLP000338 |
Gene Name | ATP6V0C |
Accession Number | NM_001694 |
Gene ID | 527 |
Species | Human |
Product Type | Lentivirus particle (overexpression) |
Insert Length | 468 bp |
Gene Alias | ATP6C,ATP6L,ATPL,VATL,Vma3,VPPC |
Fluorescent Reporter | ZsGreen |
Mammalian Cell Selection | Puromyocin |
Fusion Tag | 3xflag (C-Terminal) |
Promoter | CMV |
Resistance | Amplicin |
ORF Nucleotide Sequence | ATGTCCGAGTCCAAGAGCGGCCCCGAGTATGCTTCGTTTTTCGCCGTCATGGGCGCCTCGGCCGCCATGGTCTTCAGCGCCCTGGGCGCTGCCTATGGCACAGCCAAGAGCGGTACCGGCATTGCGGCCATGTCTGTCATGCGGCCGGAGCAGATCATGAAGTCCATCATCCCAGTGGTCATGGCTGGCATCATCGCCATCTACGGCCTGGTGGTGGCAGTCCTCATCGCCAACTCCCTGAATGACGACATCAGCCTCTACAAGAGCTTCCTCCAGCTGGGCGCCGGCCTGAGCGTGGGCCTGAGCGGCCTGGCAGCCGGCTTTGCCATCGGCATCGTGGGGGACGCTGGCGTGCGGGGCACCGCCCAGCAGCCCCGACTATTCGTGGGCATGATCCTGATTCTCATCTTCGCCGAGGTGCTCGGCCTCTACGGTCTCATCGTCGCCCTCATCCTCTCCACAAAGTAG |
ORF Protein Sequence | MSESKSGPEYASFFAVMGASAAMVFSALGAAYGTAKSGTGIAAMSVMRPEQIMKSIIPVVMAGIIAIYGLVVAVLIANSLNDDISLYKSFLQLGAGLSVGLSGLAAGFAIGIVGDAGVRGTAQQPRLFVGMILILIFAEVLGLYGLIVALILSTK |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Target Antibody | GM-Tg-g-MP0115-Ab | Anti-VATL/ ATP6V0C/ ATP6C monoclonal antibody |
Target Antigen | GM-Tg-g-MP0115-Ag | ATP6V0C VLP (virus-like particle) |
ORF Viral Vector | pGMLP000338 | Human ATP6V0C Lentivirus plasmid |
ORF Viral Vector | vGMLP000338 | Human ATP6V0C Lentivirus particle |
Target information
Target ID | GM-MP0115 |
Target Name | ATP6V0C |
Gene Group Identifier (Target Gene ID in Homo species) |
527 |
Gene ID |
100065783 (Equus caballus), 100425716 (Macaca mulatta), 101101434 (Felis catus), 11984 (Mus musculus) 170667 (Rattus norvegicus), 479877 (Canis lupus familiaris), 527 (Homo sapiens), 550622 (Bos taurus) |
Gene Symbols & Synonyms | ATP6V0C,Atp6v0c,Atpl,PL16,VATL,Vma3,Atp6c,Atp6l,Atp6c2,Atpl-rs1,ATPL,VPPC,ATP6C,ATP6L,EPEO3,PLP |
Target Alternative Names | ATP6C,ATP6L,ATP6V0C,ATPL,Atp6c,Atp6c2,Atp6l,Atp6v0c,Atpl,Atpl-rs1,EPEO3,PL16,PLP,V-ATPase 16 kDa proteolipid subunit c,V-type proton ATPase 16 kDa proteolipid subunit c,VATL,VPPC,Vacuolar proton pump 16 kDa proteolipid subunit c,Vma3 |
Uniprot Accession |
P23956,P27449,P63081,P63082
Additional SwissProt Accessions: P63082,P63081,P27449,P23956 |
Uniprot Entry Name | |
Protein Sub-location | Transmembrane Protein |
Category | |
Disease | |
Disease from KEGG | Metabolic pathways, Lysosome, Phagosome, Epithelial cell signaling in Helicobacter pylori infection, Tuberculosis, Human papillomavirus infection, Rheumatoid arthritis |
Gene Ensembl | ENSMUSG00000024121, ENSCAFG00845003893, ENSG00000185883, ENSBTAG00000026428 |
Target Classification |
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.