Human CCL19/CKb11/ELC ORF/cDNA clone-Lentivirus particle (NM_006274)

Cat. No.: vGMLP000321

Pre-made Human CCL19/CKb11/ELC Lentiviral expression plasmid for CCL19 lentivirus packaging, CCL19 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to MIP-3 Beta/CCL19/CCL19/CKb11 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP000321 Human CCL19 Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP000321
Gene Name CCL19
Accession Number NM_006274
Gene ID 6363
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 297 bp
Gene Alias CKb11,ELC,MIP-3b,MIP3B,SCYA19
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCCCTGCTACTGGCCCTCAGCCTGCTGGTTCTCTGGACTTCCCCAGCCCCAACTCTGAGTGGCACCAATGATGCTGAAGACTGCTGCCTGTCTGTGACCCAGAAACCCATCCCTGGGTACATCGTGAGGAACTTCCACTACCTTCTCATCAAGGATGGCTGCAGGGTGCCTGCTGTAGTGTTCACCACACTGAGGGGCCGCCAGCTCTGTGCACCCCCAGACCAGCCCTGGGTAGAACGCATCATCCAGAGACTGCAGAGGACCTCAGCCAAGATGAAGCGCCGCAGCAGTTAA
ORF Protein Sequence MALLLALSLLVLWTSPAPTLSGTNDAEDCCLSVTQKPIPGYIVRNFHYLLIKDGCRVPAVVFTTLRGRQLCAPPDQPWVERIIQRLQRTSAKMKRRSS

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-SE0744-Ab Anti-CCL19/ CKb11/ ELC functional antibody
    Target Antigen GM-Tg-g-SE0744-Ag CCL19 protein
    Cytokine cks-Tg-g-GM-SE0744 chemokine (C-C motif) ligand 19 (CCL19) protein & antibody
    ORF Viral Vector pGMLP000321 Human CCL19 Lentivirus plasmid
    ORF Viral Vector pGMLV001095 Human CCL19 Lentivirus plasmid
    ORF Viral Vector vGMLP000321 Human CCL19 Lentivirus particle
    ORF Viral Vector vGMLV001095 Human CCL19 Lentivirus particle


    Target information

    Target ID GM-SE0744
    Target Name MIP-3 Beta/CCL19
    Gene Group Identifier
    (Target Gene ID in Homo species)
    6363
    Gene ID 101087015 (Felis catus), 24047 (Mus musculus), 362506 (Rattus norvegicus), 448793 (Canis lupus familiaris)
    509167 (Bos taurus), 574386 (Macaca mulatta), 6363 (Homo sapiens)
    Gene Symbols & Synonyms CCL19,Ccl19,ELC,CKb11,MIP3B,Gm2023,Scya19,exodus-3,MIP-3b,SCYA19
    Target Alternative Names MIP-3 Beta, CCL19,C-C motif chemokine 19,Beta-chemokine exodus-3, CK beta-11, Epstein-Barr virus-induced molecule 1 ligand chemokine (EBI1 ligand chemokine, ELC), Macrophage inflammatory protein 3 beta (MIP-3-beta), Small-inducible cytokine A19,ELC,CKb11,MIP3B,MIP-3b,SCYA19
    Uniprot Accession O70460,Q99731
    Additional SwissProt Accessions: O70460,Q99731
    Uniprot Entry Name
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Cytokine Target
    Disease cancer
    Disease from KEGG Cytokine-cytokine receptor interaction, Viral protein interaction with cytokine and cytokine receptor, Chemokine signaling pathway, NF-kappa B signaling pathway
    Gene Ensembl ENSMUSG00000071005, ENSCAFG00845005337, ENSBTAG00000012684, ENSMMUG00000016531, ENSG00000172724
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.