Human MIP/AQP0/CTRCT15 ORF/cDNA clone-Lentivirus particle (NM_012064)

Cat. No.: vGMLP000258

Pre-made Human MIP/AQP0/CTRCT15 Lentiviral expression plasmid for MIP lentivirus packaging, MIP lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to MIP/AQP0 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP000258 Human MIP Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP000258
Gene Name MIP
Accession Number NM_012064
Gene ID 4284
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 792 bp
Gene Alias AQP0,CTRCT15,LIM1,MIP26,MP26
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGTGGGAACTGCGATCAGCCTCCTTTTGGAGGGCCATATTCGCTGAGTTCTTTGCCACCCTCTTCTATGTCTTCTTTGGGCTGGGGTCCTCACTGCGCTGGGCTCCTGGACCCCTGCATGTTCTGCAGGTGGCTATGGCATTTGGCTTGGCCCTGGCTACACTGGTGCAGTCTGTGGGCCACATCAGTGGAGCCCACGTCAATCCTGCAGTCACTTTTGCTTTCCTTGTGGGCTCCCAGATGTCCCTGCTCCGTGCCTTCTGCTATATGGCAGCCCAGCTCCTGGGAGCTGTGGCTGGGGCCGCTGTGCTGTATAGCGTTACCCCACCTGCTGTCCGAGGAAACCTAGCACTCAACACGTTGCACCCTGCGGTGAGCGTGGGCCAGGCAACCACAGTGGAGATCTTCCTGACGCTCCAGTTCGTGCTCTGCATCTTTGCCACATACGACGAGAGGCGGAATGGCCAACTGGGCTCCGTGGCCCTGGCCGTTGGCTTCTCCCTTGCCCTGGGGCACCTCTTTGGGATGTATTATACTGGTGCAGGCATGAATCCTGCCCGCTCCTTTGCTCCTGCCATTCTCACTGGGAACTTCACTAACCACTGGGTGTACTGGGTAGGCCCAATCATTGGAGGGGGTCTGGGCAGCCTCCTGTACGACTTTCTTCTCTTCCCCCGGCTCAAGAGTATTTCTGAGAGACTGTCTGTCCTCAAGGGTGCCAAACCCGATGTCTCCAATGGACAACCAGAGGTCACAGGGGAACCTGTTGAACTGAACACCCAGGCCCTGTAG
ORF Protein Sequence MWELRSASFWRAIFAEFFATLFYVFFGLGSSLRWAPGPLHVLQVAMAFGLALATLVQSVGHISGAHVNPAVTFAFLVGSQMSLLRAFCYMAAQLLGAVAGAAVLYSVTPPAVRGNLALNTLHPAVSVGQATTVEIFLTLQFVLCIFATYDERRNGQLGSVALAVGFSLALGHLFGMYYTGAGMNPARSFAPAILTGNFTNHWVYWVGPIIGGGLGSLLYDFLLFPRLKSISERLSVLKGAKPDVSNGQPEVTGEPVELNTQAL

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-MP0815-Ab Anti-MIP/ AQP0/ CTRCT15 monoclonal antibody
    Target Antigen GM-Tg-g-MP0815-Ag MIP VLP (virus-like particle)
    ORF Viral Vector pGMLP000258 Human MIP Lentivirus plasmid
    ORF Viral Vector vGMLP000258 Human MIP Lentivirus particle


    Target information

    Target ID GM-MP0815
    Target Name MIP
    Gene Group Identifier
    (Target Gene ID in Homo species)
    4284
    Gene ID 100052571 (Equus caballus), 101099733 (Felis catus), 17339 (Mus musculus), 25480 (Rattus norvegicus)
    280859 (Bos taurus), 4284 (Homo sapiens), 607104 (Canis lupus familiaris), 712901 (Macaca mulatta)
    Gene Symbols & Synonyms MIP,Mip,Cat,Cts,Hfi,Lop,Svl,Aqp0,MP26,MIP26,shrivelled,AQP0,MP22,LIM1,CTRCT15
    Target Alternative Names AQP0,Aqp0,Aquaporin-0,CTRCT15,Cat,Cts,Hfi,LIM1,Lens fiber major intrinsic protein,Lop,MIP,MIP26,MIP26 (MP26),MP22,MP26,Mip,Svl,shrivelled
    Uniprot Accession A2IBY8,P06624,P09011,P30301,P51180
    Additional SwissProt Accessions: P51180,P09011,P06624,P30301,A2IBY8
    Uniprot Entry Name
    Protein Sub-location Transmembrane Protein
    Category
    Disease
    Disease from KEGG
    Gene Ensembl ENSECAG00000008856, ENSMUSG00000025389, ENSBTAG00000010127, ENSG00000135517, ENSCAFG00845008298, ENSMMUG00000010334
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.