Human PLP2/A4/A4LSB ORF/cDNA clone-Lentivirus particle (NM_002668)

Cat. No.: vGMLP000193

Pre-made Human PLP2/A4/A4LSB Lentiviral expression plasmid for PLP2 lentivirus packaging, PLP2 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to PLP2/A4 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP000193 Human PLP2 Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP000193
Gene Name PLP2
Accession Number NM_002668
Gene ID 5355
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 459 bp
Gene Alias A4,A4LSB
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCGGATTCTGAGCGCCTCTCGGCTCCTGGCTGCTGGGCCGCCTGCACCAACTTCTCGCGCACTCGAAAGGGAATCCTCCTGTTTGCTGAGATTATATTATGCCTGGTGATCCTGATCTGCTTCAGTGCCTCCACACCAGGCTACTCCTCCCTGTCGGTGATTGAGATGATCCTTGCTGCTATTTTCTTTGTTGTCTACATGTGTGACCTGCACACCAAGATACCATTCATCAACTGGCCCTGGAGTGATTTCTTCCGAACCCTCATAGCGGCAATCCTCTACCTGATCACCTCCATTGTTGTCCTTGTTGAGAGAGGAAACCACTCCAAAATCGTCGCAGGGGTACTGGGCCTAATCGCTACGTGCCTCTTTGGCTATGATGCCTATGTCACCTTCCCCGTTCGGCAGCCAAGACATACAGCAGCCCCCACTGACCCCGCAGATGGCCCGGTGTAG
ORF Protein Sequence MADSERLSAPGCWAACTNFSRTRKGILLFAEIILCLVILICFSASTPGYSSLSVIEMILAAIFFVVYMCDLHTKIPFINWPWSDFFRTLIAAILYLITSIVVLVERGNHSKIVAGVLGLIATCLFGYDAYVTFPVRQPRHTAAPTDPADGPV

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T50072-Ab Anti-PLP2/ A4/ A4LSB monoclonal antibody
    Target Antigen GM-Tg-g-T50072-Ag PLP2 VLP (virus-like particle)
    ORF Viral Vector pGMLP000193 Human PLP2 Lentivirus plasmid
    ORF Viral Vector pGMPC000287 Human PLP2 Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector vGMLP000193 Human PLP2 Lentivirus particle


    Target information

    Target ID GM-T50072
    Target Name PLP2
    Gene Group Identifier
    (Target Gene ID in Homo species)
    5355
    Gene ID 100052104 (Equus caballus), 100683201 (Canis lupus familiaris), 101101620 (Felis catus), 18824 (Mus musculus)
    302562 (Rattus norvegicus), 399683 (Bos taurus), 5355 (Homo sapiens), 712869 (Macaca mulatta)
    Gene Symbols & Synonyms PLP2,Plp2,mIMA4,A4-LSB,A4,A4LSB
    Target Alternative Names A4,A4-LSB,A4LSB,Differentiation-dependent protein A4,Intestinal membrane A4 protein,PLP2,Plp2,Proteolipid protein 2,mIMA4
    Uniprot Accession Q04941,Q6P742,Q6Y1E2,Q9R1Q7
    Additional SwissProt Accessions: Q9R1Q7,Q6P742,Q6Y1E2,Q04941
    Uniprot Entry Name
    Protein Sub-location Transmembrane Protein
    Category Therapeutics Target
    Disease
    Disease from KEGG
    Gene Ensembl ENSMUSG00000031146, ENSBTAG00000016093, ENSG00000102007
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.