Human PLP2/A4/A4LSB ORF/cDNA clone-Lentivirus particle (NM_002668)
Cat. No.: vGMLP000193
Pre-made Human PLP2/A4/A4LSB Lentiviral expression plasmid for PLP2 lentivirus packaging, PLP2 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.
Go to
PLP2/A4 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Catalog No. | Product Name | lentivirus Grade | lentivirus quantity |
---|---|---|---|
vGMLP000193 | Human PLP2 Lentivirus particle | Pilot Grade | 1.0E+8TU |
5.0E+8TU | |||
1.0E+9TU | |||
Research Grade | 1.0E+8TU | ||
5.0E+8TU | |||
1.0E+9TU | |||
GMP-like Grade | inquiry | ||
GMP Grade | inquiry |
Product Description
Catalog ID | vGMLP000193 |
Gene Name | PLP2 |
Accession Number | NM_002668 |
Gene ID | 5355 |
Species | Human |
Product Type | Lentivirus particle (overexpression) |
Insert Length | 459 bp |
Gene Alias | A4,A4LSB |
Fluorescent Reporter | ZsGreen |
Mammalian Cell Selection | Puromyocin |
Fusion Tag | 3xflag (C-Terminal) |
Promoter | CMV |
Resistance | Amplicin |
ORF Nucleotide Sequence | ATGGCGGATTCTGAGCGCCTCTCGGCTCCTGGCTGCTGGGCCGCCTGCACCAACTTCTCGCGCACTCGAAAGGGAATCCTCCTGTTTGCTGAGATTATATTATGCCTGGTGATCCTGATCTGCTTCAGTGCCTCCACACCAGGCTACTCCTCCCTGTCGGTGATTGAGATGATCCTTGCTGCTATTTTCTTTGTTGTCTACATGTGTGACCTGCACACCAAGATACCATTCATCAACTGGCCCTGGAGTGATTTCTTCCGAACCCTCATAGCGGCAATCCTCTACCTGATCACCTCCATTGTTGTCCTTGTTGAGAGAGGAAACCACTCCAAAATCGTCGCAGGGGTACTGGGCCTAATCGCTACGTGCCTCTTTGGCTATGATGCCTATGTCACCTTCCCCGTTCGGCAGCCAAGACATACAGCAGCCCCCACTGACCCCGCAGATGGCCCGGTGTAG |
ORF Protein Sequence | MADSERLSAPGCWAACTNFSRTRKGILLFAEIILCLVILICFSASTPGYSSLSVIEMILAAIFFVVYMCDLHTKIPFINWPWSDFFRTLIAAILYLITSIVVLVERGNHSKIVAGVLGLIATCLFGYDAYVTFPVRQPRHTAAPTDPADGPV |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Target Antibody | GM-Tg-g-T50072-Ab | Anti-PLP2/ A4/ A4LSB monoclonal antibody |
Target Antigen | GM-Tg-g-T50072-Ag | PLP2 VLP (virus-like particle) |
ORF Viral Vector | pGMLP000193 | Human PLP2 Lentivirus plasmid |
ORF Viral Vector | pGMPC000287 | Human PLP2 Mammalian (Non-Viral Vector) plasmid |
ORF Viral Vector | vGMLP000193 | Human PLP2 Lentivirus particle |
Target information
Target ID | GM-T50072 |
Target Name | PLP2 |
Gene Group Identifier (Target Gene ID in Homo species) |
5355 |
Gene ID |
100052104 (Equus caballus), 100683201 (Canis lupus familiaris), 101101620 (Felis catus), 18824 (Mus musculus) 302562 (Rattus norvegicus), 399683 (Bos taurus), 5355 (Homo sapiens), 712869 (Macaca mulatta) |
Gene Symbols & Synonyms | PLP2,Plp2,mIMA4,A4-LSB,A4,A4LSB |
Target Alternative Names | PLP2,Proteolipid protein 2,Differentiation-dependent protein A4, Intestinal membrane A4 protein,A4,A4LSB |
Uniprot Accession |
Q04941,Q6P742,Q6Y1E2,Q9R1Q7
Additional SwissProt Accessions: Q9R1Q7,Q6P742,Q6Y1E2,Q04941 |
Uniprot Entry Name | |
Protein Sub-location | Transmembrane Protein |
Category | Therapeutics Target |
Disease | |
Disease from KEGG | |
Gene Ensembl | ENSMUSG00000031146, ENSBTAG00000016093, ENSG00000102007 |
Target Classification |
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.