Click here to discover the largest collection of GeneMedi's Promise-ORF™ ORF/cDNA expression clones
- • Up to 20%-50%* off first purchase
- • Bulk quantities available
- • Citation Reward application
TECHNICAL RESOURCE
Supports
- Talk to our Expert:
[email protected]
Protocol Library Download
 |
 |
Human IL17A/CTLA-8/CTLA8 ORF/cDNA clone-Lentivirus particle (NM_002190)
Cat. No.: vGMLP000168
Pre-made Human IL17A/CTLA-8/CTLA8 Lentiviral expression plasmid for IL17A lentivirus packaging, IL17A lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.
Go to
IL-17A/IL17A/IL17/IL17A/CTLA-8 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
MSDS
| Catalog No. | Product Name | lentivirus Grade | lentivirus quantity |
|---|---|---|---|
| vGMLP000168 | Human IL17A Lentivirus particle | Pilot Grade | 1.0E+8TU |
| 5.0E+8TU | |||
| 1.0E+9TU | |||
| Research Grade | 1.0E+8TU | ||
| 5.0E+8TU | |||
| 1.0E+9TU | |||
| GMP-like Grade | inquiry | ||
| GMP Grade | inquiry |
Product Description
| Catalog ID | vGMLP000168 |
| Gene Name | IL17A |
| Accession Number | NM_002190 |
| Gene ID | 3605 |
| Species | Human |
| Product Type | Lentivirus particle (overexpression) |
| Insert Length | 468 bp |
| Gene Alias | CTLA-8,CTLA8,IL-17,IL-17A,IL17 |
| Fluorescent Reporter | ZsGreen |
| Mammalian Cell Selection | Puromyocin |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | CMV |
| Resistance | Amplicin |
| ORF Nucleotide Sequence | ATGACTCCTGGGAAGACCTCATTGGTGTCACTGCTACTGCTGCTGAGCCTGGAGGCCATAGTGAAGGCAGGAATCACAATCCCACGAAATCCAGGATGCCCAAATTCTGAGGACAAGAACTTCCCCCGGACTGTGATGGTCAACCTGAACATCCATAACCGGAATACCAATACCAATCCCAAAAGGTCCTCAGATTACTACAACCGATCCACCTCACCTTGGAATCTCCACCGCAATGAGGACCCTGAGAGATATCCCTCTGTGATCTGGGAGGCAAAGTGCCGCCACTTGGGCTGCATCAACGCTGATGGGAACGTGGACTACCACATGAACTCTGTCCCCATCCAGCAAGAGATCCTGGTCCTGCGCAGGGAGCCTCCACACTGCCCCAACTCCTTCCGGCTGGAGAAGATACTGGTGTCCGTGGGCTGCACCTGTGTCACCCCGATTGTCCACCATGTGGCCTAA |
| ORF Protein Sequence | MTPGKTSLVSLLLLLSLEAIVKAGITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Target information
| Target ID | GM-T22095 |
| Target Name | IL-17A/IL17A/IL17 |
|
Gene Group Identifier （Target Gene ID in Homo species) |
3605 |
| Gene ID |
100034142 (Equus caballus), 101095339 (Felis catus), 16171 (Mus musculus), 282863 (Bos taurus) 301289 (Rattus norvegicus), 3605 (Homo sapiens), 481837 (Canis lupus familiaris), 708123 (Macaca mulatta) |
| Gene Symbols & Synonyms | IL17A,Il17a,IL17,Il17,Ctla8,IL-17,Ctla-8,IL-17A,CTLA-8,CTLA8,ILA17 |
| Target Alternative Names | CTLA-8,CTLA8,Ctla-8,Ctla8,Cytotoxic T-lymphocyte-associated antigen 8 (CTLA-8),IL-17,IL-17A,IL17,IL17A,ILA17,Il17,Il17a,Interleukin-17A |
| Uniprot Accession |
Q16552,Q61453,Q62386,Q687Y7
Additional SwissProt Accessions: Q62386,Q687Y7,Q61453,Q16552 |
| Uniprot Entry Name | |
| Protein Sub-location | Secreted Protein/Potential Cytokines |
| Category | Therapeutics Target, Immuno-oncology Target, INN Index, Cytokine Target |
| Disease | cancer |
| Disease from KEGG | Cytokine-cytokine receptor interaction, IL-17 signaling pathway, Th17 cell differentiation, Alcoholic liver disease, Inflammatory bowel disease, Rheumatoid arthritis |
| Gene Ensembl | ENSECAG00000038266, ENSMUSG00000025929, ENSBTAG00000002150, ENSG00000112115, ENSMMUG00000007403 |
| Target Classification | Checkpoint-Immuno Oncology, Tumor-associated antigen (TAA) |
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.