Human HAMP/HEPC/HFE2B ORF/cDNA clone-Lentivirus particle (NM_021175)

Cat. No.: vGMLP000047

Pre-made Human HAMP/HEPC/HFE2B Lentiviral expression plasmid for HAMP lentivirus packaging, HAMP lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to HAMP/HEPC products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

pdf MSDS
pdf Datasheet

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP000047 Human HAMP Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP000047
Gene Name HAMP
Accession Number NM_021175
Gene ID 57817
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 255 bp
Gene Alias HEPC,HFE2B,LEAP1,PLTR
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCACTGAGCTCCCAGATCTGGGCCGCTTGCCTCCTGCTCCTCCTCCTCCTCGCCAGCCTGACCAGTGGCTCTGTTTTCCCACAACAGACGGGACAACTTGCAGAGCTGCAACCCCAGGACAGAGCTGGAGCCAGGGCCAGCTGGATGCCCATGTTCCAGAGGCGAAGGAGGCGAGACACCCACTTCCCCATCTGCATTTTCTGCTGCGGCTGCTGTCATCGATCAAAGTGTGGGATGTGCTGCAAGACGTAG
ORF Protein Sequence MALSSQIWAACLLLLLLLASLTSGSVFPQQTGQLAELQPQDRAGARASWMPMFQRRRRRDTHFPICIFCCGCCHRSKCGMCCKT

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T22995-Ab Anti-HEPC/ HAMP/ HFE2B functional antibody
    Target Antigen GM-Tg-g-T22995-Ag HAMP protein
    ORF Viral Vector pGMLP000047 Human HAMP Lentivirus plasmid
    ORF Viral Vector vGMLP000047 Human HAMP Lentivirus particle


    Target information

    Target ID GM-T22995
    Target Name HAMP
    Gene Group Identifier
    （Target Gene ID in Homo species)         		57817
    Gene ID 100050728 (Equus caballus), 101084332 (Felis catus), 492281 (Canis lupus familiaris), 512301 (Bos taurus)
    57817 (Homo sapiens), 708397 (Macaca mulatta), 84506 (Mus musculus), 84604 (Rattus norvegicus)
    Gene Symbols & Synonyms HAMP,Hamp,hepcidin,HEPC,PLTR,HFE2B,LEAP1,Hepc,Hamp1,Hepc1
    Target Alternative Names HAMP,Hepcidin,Liver-expressed antimicrobial peptide 1 (LEAP-1), Putative liver tumor regressor (PLTR),HEPC,PLTR,HFE2B,LEAP1
    Uniprot Accession P81172,Q5U9D2,Q99MH3,Q9EQ21
    Additional SwissProt Accessions: Q5U9D2,P81172,Q9EQ21,Q99MH3
    Uniprot Entry Name
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Therapeutics Target
    Disease Ovary Cancer
    Disease from KEGG TGF-beta signaling pathway
    Gene Ensembl ENSCAFG00845003240, ENSBTAG00000017042, ENSG00000105697, ENSMMUG00000011288, ENSMUSG00000050440
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.