Human IFI30/GILT/IFI-30 ORF/cDNA clone-Lentivirus particle (NM_006332)

Cat. No.: vGMLP000039

Pre-made Human IFI30/GILT/IFI-30 Lentiviral expression plasmid for IFI30 lentivirus packaging, IFI30 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to IFI30/GILT products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

pdf MSDS
pdf Datasheet

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP000039 Human IFI30 Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP000039
Gene Name IFI30
Accession Number NM_006332
Gene ID 10437
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 753 bp
Gene Alias GILT,IFI-30,IP-30,IP30
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGACCCTGTCGCCACTTCTGCTGTTCCTGCCACCGCTGCTGCTGCTGCTGGACGTCCCCACGGCGGCGGTGCAGGCGTCCCCTCTGCAAGCGTTAGACTTCTTTGGGAATGGGCCACCAGTTAACTACAAGACAGGCAATCTATACCTGCGGGGGCCCCTGAAGAAGTCCAATGCACCGCTTGTCAATGTGACCCTCTACTATGAAGCACTGTGCGGTGGCTGCCGAGCCTTCCTGATCCGGGAGCTCTTCCCAACATGGCTGTTGGTCATGGAGATCCTCAATGTCACGCTGGTGCCCTACGGAAACGCACAGGAACAAAATGTCAGTGGCAGGTGGGAGTTCAAGTGCCAGCATGGAGAAGAGGAGTGCAAATTCAACAAGGTGGAGGCCTGCGTGTTGGATGAACTTGACATGGAGCTAGCCTTCCTGACCATTGTCTGCATGGAAGAGTTTGAGGACATGGAGAGAAGTCTGCCACTATGCCTGCAGCTCTACGCCCCAGGGCTGTCGCCAGACACTATCATGGAGTGTGCAATGGGGGACCGCGGCATGCAGCTCATGCACGCCAACGCCCAGCGGACAGATGCTCTCCAGCCACCACACGAGTATGTGCCCTGGGTCACCGTCAATGGGAAACCCTTGGAAGATCAGACCCAGCTCCTTACCCTTGTCTGCCAGTTGTACCAGGGCAAGAAGCCGGATGTCTGCCCTTCCTCAACCAGCTCCCTCAGGAGTGTTTGCTTCAAGTGA
ORF Protein Sequence MTLSPLLLFLPPLLLLLDVPTAAVQASPLQALDFFGNGPPVNYKTGNLYLRGPLKKSNAPLVNVTLYYEALCGGCRAFLIRELFPTWLLVMEILNVTLVPYGNAQEQNVSGRWEFKCQHGEEECKFNKVEACVLDELDMELAFLTIVCMEEFEDMERSLPLCLQLYAPGLSPDTIMECAMGDRGMQLMHANAQRTDALQPPHEYVPWVTVNGKPLEDQTQLLTLVCQLYQGKKPDVCPSSTSSLRSVCFK

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-SE0276-Ab Anti-GILT/ IFI30/ IFI-30 functional antibody
    Target Antigen GM-Tg-g-SE0276-Ag IFI30 protein
    ORF Viral Vector pGMLP000039 Human IFI30 Lentivirus plasmid
    ORF Viral Vector vGMLP000039 Human IFI30 Lentivirus particle


    Target information

    Target ID GM-SE0276
    Target Name IFI30
    Gene Group Identifier
    （Target Gene ID in Homo species)         		10437
    Gene ID 100070878 (Equus caballus), 101093838 (Felis catus), 10437 (Homo sapiens), 290644 (Rattus norvegicus)
    476669 (Canis lupus familiaris), 615930 (Bos taurus), 65972 (Mus musculus), 719379 (Macaca mulatta)
    Gene Symbols & Synonyms IFI30,Ifi30,GILT,IP30,IP-30,IFI-30
    Target Alternative Names IFI30,Gamma-interferon-inducible lysosomal thiol reductase,Gamma-interferon-inducible protein IP-30, Legumaturain,GILT,IP30,IP-30,IFI-30
    Uniprot Accession A6QPN6,P13284,Q499T2,Q9ESY9
    Additional SwissProt Accessions: P13284,Q499T2,A6QPN6,Q9ESY9
    Uniprot Entry Name
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category
    Disease
    Disease from KEGG Antigen processing and presentation
    Gene Ensembl ENSECAG00000013896, ENSG00000216490, ENSCAFG00845023402, ENSBTAG00000018349, ENSMUSG00000031838, ENSMMUG00000051543
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.