Human IL36RN/FIL1/FIL1(DELTA) ORF/cDNA clone-Lentivirus particle (NM_012275)

Cat. No.: vGMLP-IL-042

Pre-made Human IL36RN/FIL1/FIL1(DELTA) Lentiviral expression plasmid for IL36RN lentivirus packaging, IL36RN lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to IL-36RN/IL36RN/IL36RN/FIL1 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP-IL-042 Human IL36RN Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP-IL-042
Gene Name IL36RN
Accession Number NM_012275
Gene ID 26525
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 468 bp
Gene Alias FIL1,FIL1(DELTA),FIL1D,IL-36Ra,IL1F5,IL1HY1,IL1L1,IL1RP3,IL36RA,PSORP,PSORS14
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGTCCTGAGTGGGGCGCTGTGCTTCCGAATGAAGGACTCGGCATTGAAGGTGCTTTATCTGCATAATAACCAGCTTCTAGCTGGAGGGCTGCATGCAGGGAAGGTCATTAAAGGTGAAGAGATCAGCGTGGTCCCCAATCGGTGGCTGGATGCCAGCCTGTCCCCCGTCATCCTGGGTGTCCAGGGTGGAAGCCAGTGCCTGTCATGTGGGGTGGGGCAGGAGCCGACTCTAACACTAGAGCCAGTGAACATCATGGAGCTCTATCTTGGTGCCAAGGAATCCAAGAGCTTCACCTTCTACCGGCGGGACATGGGGCTCACCTCCAGCTTCGAGTCGGCTGCCTACCCGGGCTGGTTCCTGTGCACGGTGCCTGAAGCCGATCAGCCTGTCAGACTCACCCAGCTTCCCGAGAATGGTGGCTGGAATGCCCCCATCACAGACTTCTACTTCCAGCAGTGTGACTAG
ORF Protein Sequence MVLSGALCFRMKDSALKVLYLHNNQLLAGGLHAGKVIKGEEISVVPNRWLDASLSPVILGVQGGSQCLSCGVGQEPTLTLEPVNIMELYLGAKESKSFTFYRRDMGLTSSFESAAYPGWFLCTVPEADQPVRLTQLPENGGWNAPITDFYFQQCD

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Biosimilar GMP-Bios-ab-532 Pre-Made Spesolimab biosimilar, Whole mAb, Anti-IL36RN/IL-36R Antibody: Anti-FIL1/FIL1(DELTA)/FIL1D/IL1F5/IL1HY1/IL1L1/IL1RP3/IL36RA/PSORP/PSORS14 therapeutic antibody
    Target Antibody GM-Tg-g-SE0627-Ab Anti-I36RA/ IL36RN/ FIL1 functional antibody
    Target Antigen GM-Tg-g-SE0627-Ag IL36RN protein
    Cytokine cks-Tg-g-GM-SE0627 interleukin 36 receptor antagonist (IL36RN) protein & antibody
    ORF Viral Vector pGMLP004790 Human IL36RN Lentivirus plasmid
    ORF Viral Vector pGMLP-IL-042 Human IL36RN Lentivirus plasmid
    ORF Viral Vector pGMAP-IL-125 Human IL36RN Adenovirus plasmid
    ORF Viral Vector vGMLP004790 Human IL36RN Lentivirus particle
    ORF Viral Vector vGMLP-IL-042 Human IL36RN Lentivirus particle
    ORF Viral Vector vGMAP-IL-125 Human IL36RN Adenovirus particle


    Target information

    Target ID GM-SE0627
    Target Name IL-36RN/IL36RN
    Gene Group Identifier
    (Target Gene ID in Homo species)
    26525
    Gene ID 100065154 (Equus caballus), 26525 (Homo sapiens), 311783 (Rattus norvegicus), 518514 (Bos taurus)
    54450 (Mus musculus), 611869 (Canis lupus familiaris), 705268 (Macaca mulatta)
    Gene Symbols & Synonyms IL36RN,Il36rn,FIL1,FIL1D,IL1F5,IL1L1,PSORP,IL1HY1,IL1RP3,IL36RA,IL-36Ra,PSORS14,FIL1(DELTA),Il1f5,If36rn,Il-1h3,Il1hy1,Fil1delta
    Target Alternative Names FIL1,FIL1 delta,FIL1(DELTA),FIL1D,Fil1delta,IL-1-related protein 3 (IL-1RP3),IL-36RN,IL-36Ra,IL1F5,IL1HY1,IL1L1,IL1RP3,IL36RA,IL36RN,If36rn,Il-1h3,Il1f5,Il1hy1,Il36rn,Interleukin-1 HY1 (IL-1HY1),Interleukin-1 delta (IL-1 delta),Interleukin-1 family member 5 (IL-1F5),Interleukin-1 receptor antagonist homolog 1 (IL-1ra homolog 1),Interleukin-1-like protein 1 (IL-1L1),Interleukin-36 receptor antagonist protein,PSORP,PSORS14
    Uniprot Accession Q9QYY1,Q9UBH0
    Additional SwissProt Accessions: Q9UBH0,Q9QYY1
    Uniprot Entry Name
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Therapeutics Target, INN Index, Cytokine Target
    Disease
    Disease from KEGG Cytokine-cytokine receptor interaction
    Gene Ensembl ENSECAG00000020486, ENSG00000136695, ENSBTAG00000039839, ENSMUSG00000026983, ENSCAFG00845011829, ENSMMUG00000061691
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.