Human IL36A/FIL1/FIL1(EPSILON) ORF/cDNA clone-Lentivirus particle (NM_014440)

Cat. No.: vGMLP-IL-039

Pre-made Human IL36A/FIL1/FIL1(EPSILON) Lentiviral expression plasmid for IL36A lentivirus packaging, IL36A lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to IL-1F6/IL-36 Alpha/IL36A/IL36A/FIL1 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP-IL-039 Human IL36A Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP-IL-039
Gene Name IL36A
Accession Number NM_014440
Gene ID 27179
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 477 bp
Gene Alias FIL1,FIL1(EPSILON),FIL1E,IL-1F6,IL1(EPSILON),IL1F6
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGAAAAAGCATTGAAAATTGACACACCTCAGCAGGGGAGCATTCAGGATATCAATCATCGGGTGTGGGTTCTTCAGGACCAGACGCTCATAGCAGTCCCGAGGAAGGACCGTATGTCTCCAGTCACTATTGCCTTAATCTCATGCCGACATGTGGAGACCCTTGAGAAAGACAGAGGGAACCCCATCTACCTGGGCCTGAATGGACTCAATCTCTGCCTGATGTGTGCTAAAGTCGGGGACCAGCCCACACTGCAGCTGAAGGAAAAGGATATAATGGATTTGTACAACCAACCCGAGCCTGTGAAGTCCTTTCTCTTCTACCACAGCCAGAGTGGCAGGAACTCCACCTTCGAGTCTGTGGCTTTCCCTGGCTGGTTCATCGCTGTCAGCTCTGAAGGAGGCTGTCCTCTCATCCTTACCCAAGAACTGGGGAAAGCCAACACTACTGACTTTGGGTTAACTATGCTGTTTTAA
ORF Protein Sequence MEKALKIDTPQQGSIQDINHRVWVLQDQTLIAVPRKDRMSPVTIALISCRHVETLEKDRGNPIYLGLNGLNLCLMCAKVGDQPTLQLKEKDIMDLYNQPEPVKSFLFYHSQSGRNSTFESVAFPGWFIAVSSEGGCPLILTQELGKANTTDFGLTMLF

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-SE1029-Ab Anti-IL36A/ FIL1/ FIL1(EPSILON) functional antibody
    Target Antigen GM-Tg-g-SE1029-Ag IL36A protein
    Cytokine cks-Tg-g-GM-SE1029 IL-1 F6 (IL36A) protein & antibody
    ORF Viral Vector pGMLP-IL-039 Human IL36A Lentivirus plasmid
    ORF Viral Vector pGMAP-IL-122 Human IL36A Adenovirus plasmid
    ORF Viral Vector vGMLP-IL-039 Human IL36A Lentivirus particle
    ORF Viral Vector vGMAP-IL-122 Human IL36A Adenovirus particle


    Target information

    Target ID GM-SE1029
    Target Name IL-1F6/IL-36 Alpha/IL36A
    Gene Group Identifier
    (Target Gene ID in Homo species)
    27179
    Gene ID 27179 (Homo sapiens), 296541 (Rattus norvegicus), 705136 (Macaca mulatta)
    Gene Symbols & Synonyms IL36A,Il36a,FIL1,FIL1E,IL1F6,IL-1F6,IL1(EPSILON),FIL1(EPSILON),Il1f6
    Target Alternative Names FIL1,FIL1 epsilon,FIL1(EPSILON),FIL1E,IL-1F6,IL-36 Alpha,IL1(EPSILON),IL1F6,IL36A,Il1f6,Il36a,Interleukin-1 epsilon (IL-1 epsilon),Interleukin-1 family member 6 (IL-1F6),Interleukin-36 alpha
    Uniprot Accession Q9UHA7
    Additional SwissProt Accessions: Q9UHA7
    Uniprot Entry Name
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Cytokine Target
    Disease
    Disease from KEGG Cytokine-cytokine receptor interaction
    Gene Ensembl ENSG00000136694, ENSMMUG00000000988
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.