Human IL25/IL17E ORF/cDNA clone-Lentivirus particle (NM_022789)

Cat. No.: vGMLP-IL-032

Pre-made Human IL25/IL17E Lentiviral expression plasmid for IL25 lentivirus packaging, IL25 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to IL25/IL17E products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

pdf MSDS
pdf Datasheet

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP-IL-032 Human IL25 Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP-IL-032
Gene Name IL25
Accession Number NM_022789
Gene ID 64806
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 534 bp
Gene Alias IL17E
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGAGGGAGCGACCCAGATTAGGTGAGGACAGTTCTCTCATTAGCCTTTTCCTACAGGTGGTTGCATTCTTGGCAATGGTCATGGGAACCCACACCTACAGCCACTGGCCCAGCTGCTGCCCCAGCAAAGGGCAGGACACCTCTGAGGAGCTGCTGAGGTGGAGCACTGTGCCTGTGCCTCCCCTAGAGCCTGCTAGGCCCAACCGCCACCCAGAGTCCTGTAGGGCCAGTGAAGATGGACCCCTCAACAGCAGGGCCATCTCCCCCTGGAGATATGAGTTGGACAGAGACTTGAACCGGCTCCCCCAGGACCTGTACCACGCCCGTTGCCTGTGCCCGCACTGCGTCAGCCTACAGACAGGCTCCCACATGGACCCCCGGGGCAACTCGGAGCTGCTCTACCACAACCAGACTGTCTTCTACCGGCGGCCATGCCATGGCGAGAAGGGCACCCACAAGGGCTACTGCCTGGAGCGCAGGCTGTACCGTGTTTCCTTAGCTTGTGTGTGTGTGCGGCCCCGTGTGATGGGCTAG
ORF Protein Sequence MRERPRLGEDSSLISLFLQVVAFLAMVMGTHTYSHWPSCCPSKGQDTSEELLRWSTVPVPPLEPARPNRHPESCRASEDGPLNSRAISPWRYELDRDLNRLPQDLYHARCLCPHCVSLQTGSHMDPRGNSELLYHNQTVFYRRPCHGEKGTHKGYCLERRLYRVSLACVCVRPRVMG

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T62241-Ab Anti-IL25/ IL17E functional antibody
    Target Antigen GM-Tg-g-T62241-Ag IL25 protein
    Cytokine cks-Tg-g-GM-T62241 Interleukin 25 (IL25) protein & antibody
    ORF Viral Vector pGMAP000371 Human IL25 Adenovirus plasmid
    ORF Viral Vector pGMLP-IL-032 Human IL25 Lentivirus plasmid
    ORF Viral Vector pGMAP-IL-115 Human IL25 Adenovirus plasmid
    ORF Viral Vector vGMAP000371 Human IL25 Adenovirus particle
    ORF Viral Vector vGMLP-IL-032 Human IL25 Lentivirus particle
    ORF Viral Vector vGMAP-IL-115 Human IL25 Adenovirus particle


    Target information

    Target ID GM-T62241
    Target Name IL25
    Gene Group Identifier
    （Target Gene ID in Homo species)         		64806
    Gene ID 101095746 (Felis catus), 111768801 (Equus caballus), 140806 (Mus musculus), 480252 (Canis lupus familiaris)
    501996 (Rattus norvegicus), 526816 (Bos taurus), 64806 (Homo sapiens), 713943 (Macaca mulatta)
    Gene Symbols & Synonyms IL25,Il25,IL-25,Il17e,IL-17e,RGD1561632,IL17E
    Target Alternative Names IL-17e,IL-25,IL17E,IL25,Il17e,Il25,Interleukin-17E (IL-17E),Interleukin-25,RGD1561632
    Uniprot Accession Q8VHH8,Q9H293
    Additional SwissProt Accessions: Q8VHH8,Q9H293
    Uniprot Entry Name
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Therapeutics Target, Cytokine Target
    Disease
    Disease from KEGG Cytokine-cytokine receptor interaction, IL-17 signaling pathway
    Gene Ensembl ENSMUSG00000040770, ENSCAFG00845003612, ENSBTAG00000009701, ENSG00000166090
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.